KEGG   Scleropages formosus (Asian bonytongue): 108919511Help
Entry
108919511         CDS       T04919                                 

Gene name
wdhd1
Definition
(RefSeq) WD repeat and HMG-box DNA-binding protein 1
  KO
K11274  chromosome transmission fidelity protein 4
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sfm03036]
    108919511 (wdhd1)
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    108919511 (wdhd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid WD40 ANAPC4_WD40 eIF2A HMG_box
Motif
Other DBs
NCBI-GeneID: 108919511
NCBI-ProteinID: XP_018583019
LinkDB All DBs
Position
15
AA seq 1122 aa AA seqDB search
MPAERKALRYGHSEGHTDVCFDDTGRYIVTCGSDGDVRIWEGLDDDDPKSINVGERAYSV
ALKNGKLVTAVSNNTVQLHTFPEGDPDGILTRFTTNANHVTFNGDGSRVAAGSSDFMVKI
VEVSDSSQQKTLRGHQAPILSVAFDPKDEFLGSSSCDGSVAVWKIDDQVQVVSWNVLQKS
SDVSNAKSLCRLAWQPGFGKLLAVPADKSVQLYERNSWNNVSRLSDDFIAQPVNVVAWSP
CGKFLAAATIGGFIVVWDVDTKQCIERQKHEKGYTVCGLSWHPSGGQIVYTDTEGCLGLL
DGVAASSPQHGSKNNEMVVNKAMGNYDDLFDEDDDGHLAEDLSENGLAANTVTGGGNEDD
EDDDLMPSTGRPRNRGAFLDDDDDTSVDAGSVKYENDGRVGTPLPSVPCPAVSQPRYEGP
MPTPPQKPFQPGSTPVHLMHRFLVWNSVGIVRGYNDEQDNAVDVEFHDTSVHHAMHLTNT
LGHTMADMSQEAVLLACEGTDELASKIQCLHFSSWDTNKEWMVDLPKEENAKALCLGQGW
AAVATSALLVRIFSIGGLQREIFSLPGPAVCMAGHGQQLLIAYHRGTGFDGEQALGVQLL
QFGQKKRQVIHGEPLPLSQKSYLSWMGFSAEGTPCFVDSEGTVRMLNRSLGNTWTPVCST
RESCKGTSDHYWVVGVHENPQQLRCIPCKGSRFPPTLPRPAVAILPFKLPFCQTATEKGH
MEEQYWRSLLFQNHLDFLSSSGYEIDEEARSKGQKEQQELLMKMFALSCKLERELRCMEL
AELMTHSVVTLAIRYATRSHRMALAQRLGELALEKATAQHEEDHEDDEEQSELPSTRQMS
GYSQTGSKWKESHQPNCQQTQKEELEDEDLGEQDDREGMDSREGTEGRKPCLPLFNKADI
SPERTSLKPSSKEGRVNPFKVSASNPSGLSAQPRATNVLDSMTPSSRKPLSLGISGGKQS
KEPALKPLVPRPKSKTQVTLLQMNCPKIARKNLEPATEEPAQKDTISPASPPASTENLKP
KTGFQLWLEENRKRILADKPDLDETDIIKEAMSLFRALSAEDRLSWTERAKGQSGGTADL
KKRKRREENVEEKRNELQENSTKKTKTVDTSARLSAFAFNKT
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcggagaggaaagcgctgcgctatggtcactcggaaggacacacggacgtttgc
ttcgacgacacgggcaggtacattgtgacctgtggaagtgatggtgacgttcggatatgg
gaaggtttggatgacgacgacccgaagtccattaacgtgggggagagggcttattctgta
gccttaaagaatggaaaattggtcactgcggtgtccaacaataccgtccagcttcacacg
tttcccgaaggcgatccagatggaatcctgacacgcttcaccactaacgccaaccacgtg
acctttaacggcgatgggtcaagagtggccgctggatccagtgactttatggtgaaaatt
gtggaggtgtctgacagcagtcagcagaagacgctgcgtggacatcaagcacctatcctg
agtgtggcctttgacccgaaggatgagtttttgggctcttctagctgtgatggatctgta
gctgtgtggaaaatagatgaccaggtacaggtggtcagctggaatgtgttgcagaaatcc
agcgatgtcagcaatgccaaatctctgtgtagactggcctggcagccaggtttcggaaag
ctcttggctgttccagctgacaaatctgtgcagctgtatgagaggaactcttggaacaac
gtgagcagactttctgatgacttcatcgcacagcctgtgaatgtggtagcctggtctccc
tgtggaaagttccttgctgctgccactattgggggtttcattgtagtgtgggatgtggac
accaagcagtgtatagagaggcaaaagcacgagaagggttatacagtgtgtgggctatcc
tggcatccatctgggggtcaaatagtctatactgacaccgagggctgcttgggacttctg
gatggggtggctgcctcatctccccaacatgggtcgaagaacaatgagatggtagtaaac
aaagcgatgggaaactatgatgacctgtttgatgaggatgacgatggccatctcgcagag
gacttgagtgaaaacggcttggcagctaacaccgtcaccggtggtggcaatgaagatgat
gaagacgatgacctgatgccctccaccggaagacctcggaaccgtggagccttcctcgat
gatgacgacgacacttccgttgatgctggttcagtgaagtacgagaatgatggtagggtt
ggcacccccctgccctctgtgccttgtccagctgtgtcccagccccgctatgaggggccc
atgcccacacccccacagaaaccgtttcagcccggatctactcctgtgcacctcatgcat
cgtttcttggtgtggaactcagttggaatcgtgcgtgggtacaatgacgagcaggacaat
gccgttgacgtggaattccatgacacgtccgttcaccacgccatgcacctcaccaacact
cttggccacaccatggccgacatgtcccaggaggcagtgctgctggcctgcgagggaacg
gatgagcttgctagtaagatccagtgcttgcacttctcttcctgggacaccaacaaggaa
tggatggtggaccttcccaaagaggagaatgccaaggctctatgtctggggcagggttgg
gcggctgtggccaccagtgccctgctggtgcggatcttctccattggtgggttgcagagg
gaaatcttcagcctacccggacccgcagtgtgcatggcaggacatggacaacagctgctt
attgcttaccaccgaggtactggatttgatggagaacaggctctcggggtccagttgctg
cagtttggccagaagaagaggcaggttatccatggggagccactcccactctctcagaag
tcatacctttcttggatgggtttcagcgctgagggcacaccgtgctttgttgactcggag
ggcacggtgcgcatgctaaaccgcagccttgggaacacatggactccagtatgcagcact
cgagaaagctgcaaggggacgtcggaccactactgggtggtgggtgtccatgagaacccc
cagcagctcaggtgtattccttgtaaagggtcccgctttcctccaacactgcctcgccct
gctgtggcaatccttcctttcaagctgcccttctgccagaccgccacagagaagggtcat
atggaggagcagtactggagatctctgctcttccaaaatcacttagacttcctgtcctcc
agtggatatgaaatagacgaggaggcaaggagcaagggtcaaaaggaacagcaggagctg
ctgatgaagatgtttgcgctgtcgtgcaaactggagagggagttgcgctgcatggagctg
gcggagctgatgacccatagcgtggtcacgctggcgatccgttatgccacacgctcccat
aggatggccctggcacagcgtcttggagagcttgccctggagaaggcgaccgctcagcac
gaggaagatcacgaagatgacgaagagcaatctgaattgcctagcactaggcagatgtct
gggtatagccaaacaggcagtaagtggaaagagagccatcagccaaattgccagcaaaca
cagaaggaagagctggaagacgaggatttgggggagcaagatgaccgggaggggatggat
tctagagagggaacggagggccggaaaccttgtttgcctctgttcaacaaagctgacatc
tcaccagaaagaacatctttaaaaccctctagcaaagaagggcgcgttaatcctttcaag
gtgtctgcgtcaaacccttctggtttgtctgctcagccccgggcaaccaatgtcctggac
agcatgacaccatcaagcagaaaacctttgtcactaggaatctctggaggaaaacaaagt
aaggaaccagctctgaaacccctggttccacgacccaagtcaaagactcaggttactctg
ctacagatgaattgtccaaagattgcaagaaagaatctagaaccagctacagaagaacca
gcacagaaagacactatttctcctgctagccctcctgccagtacagagaacttgaaacca
aagactggtttccagctgtggcttgaagagaaccgtaaaaggatcctggctgataaacca
gacctggatgaaaccgatatcatcaaggaagccatgagcctgtttcgggccctgtcagct
gaggacagactgtcctggacagagagagctaaagggcagtctggagggactgcagatctg
aagaaaagaaagaggagagaggagaatgtggaggagaagaggaacgagctgcaggagaac
agtaccaagaaaaccaagaccgtggacacgtcagctaggctgtctgcgttcgctttcaac
aaaacctga

DBGET integrated database retrieval system