KEGG   Scleropages formosus (Asian bonytongue): 108919583Help
Entry
108919583         CDS       T04919                                 

Gene name
ganc
Definition
(RefSeq) neutral alpha-glucosidase C isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00052  Galactose metabolism
sfm00500  Starch and sucrose metabolism
sfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108919583 (ganc)
   00500 Starch and sucrose metabolism
    108919583 (ganc)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108919583 (ganc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 108919583
NCBI-ProteinID: XP_018583179
UniProt: A0A1W4XUE1
LinkDB All DBs
Position
Unknown
AA seq 903 aa AA seqDB search
MAEKKSEKNSESVIPSDKETNRFKKCEQIAFYRRQKLGARQQYELLLDTFVLTEKGAGMV
LLDPNIEVQLFMQVCAIKAGAVRVTIDEWKPIRPRFRVPDVLTGEPVYERMRVEKKDKKN
AVTLTWGTGQYQIRIQAHPLLLQVFCDGEVTASLNEQGRLFFETVKDPPKQRISEADKDE
QEDSEGLWRETFKKFVDIKANGPTSVGLDFGLHGFSHVYGLPEHADTLRLKDTSDGEPYR
LYNLDVFGYSIHSPLGLYGSVPFLLAHSPDRTVGAFWLNASETLLDVQYDCKKGPAPPKA
NRREVLPHTNLRWMSESGVIDSFILLGPSPSHTFLQYAELTGYQALPPLFSLGYHQCRWS
YDDEADVKAVDAGFDRHAIPYDVIWLDIEHTRQNRYFTWDSQLFPDPVGLQRHLQERERK
LVVISDPHIKVDPSWELYSEAQDRGYFVRDREGKLYNGRCWPGESCYLDFTSPEVRAWYS
SLFALDKYKGSTDSLHVWNDMNEPSVFGGPEQTMPKDAVHHGGVEHRELHNLYGFYQHLA
TVEGLISRSGGLERPFVLSRSFFAGSQRLGAVWTGDNLATWEYLKISIPMLLSLSIVGVA
FCGADVGGFFQDPKPELLIRWYQAGSLQPFFRGHSAKMMKRREPWLFGDTVTAAIRNAVQ
QRYCLLPYWYTLFHQAHTSAKPPIRPLWVEFSKEQDTFTVEHEYMIGSALLACPVTDPGA
TKVKVLLPGSGENWYDVQTKRIYSGGRTLSLAVTLDTVPLFQRGGTVIPRRTKPGSCSAD
LQKMPFSLTVALDSNGCAEGYLYLDDGHSFNYRDKKHFALRRFSLQKGHLKCCCTDNTGQ
FDSGCLVQSVTFLGVKKKPSAVTTLLSEVEEICCTVQYQEDQHLLMVGNLSLPVGKDWDM
WIR
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaagaaatcagaaaaaaacagcgaaagtgtcatcccaagtgacaaggagaca
aacaggtttaagaaatgcgagcaaatagcattttatagacgacaaaagctgggagccaga
cagcagtatgagctcttgctggacacttttgtgctgacagagaagggagcagggatggtt
cttttggacccaaacattgaggtgcaactttttatgcaagtgtgtgccatcaaagccggg
gctgttagggtcaccattgacgaatggaagcccatcagaccgcgcttcagggttccagat
gttttgaccggagaaccagtttatgagcggatgcgagtggagaagaaggataagaagaac
gcagtcacactgacatggggtacaggtcaataccagatccggatacaggcccatccgttg
ttactgcaggtgttctgtgatggggaggtaacagcctcactcaacgagcagggcagactg
ttctttgagacggtgaaggatccaccaaagcagaggatctcagaagcagacaaagatgaa
caagaggactctgaaggtctatggagagagacttttaaaaaatttgtagacatcaaggca
aatggtccaacatctgtgggtctggacttcggcctccatggtttttcacatgtgtatggt
ctccctgagcatgcagacaccctccggctgaaggacaccagtgatggagaaccgtaccgc
ctgtacaacctggacgtcttcggatactccattcacagcccgctgggcctttatggttcg
gtaccattcctactggcacacagtcccgacagaaccgtcggtgcattctggctcaatgcg
tcggagacgctgctggatgtccagtacgattgcaagaagggacccgctccacctaaagca
aataggagggaggtgcttccccataccaacctgcgctggatgtcagagagcggtgtgatc
gacagcttcatcctgctgggacccagtccgtcacacacattcttacagtatgctgagctc
acaggataccaagctctgcctccccttttctccctgggctaccaccagtgccgctggagt
tacgacgatgaggctgacgtgaaggcggtggacgctggctttgaccgccatgccatcccc
tacgacgtcatctggctggacattgagcacacgcgccagaaccgctacttcacctgggat
tcacaactcttccctgatcctgttggcctacagcgccacctgcaggaaagggaaagaaag
ctggtggtcatcagcgatcctcacattaaggttgacccttcctgggagctttacagtgag
gcccaggaccgtggctactttgttagagacagggagggaaagctgtataatgggcgctgt
tggccaggtgagtcatgttacctggacttcactagtccagaggtgcgagcatggtactcc
agtctctttgctctggacaaatacaagggctccacagattctttacatgtatggaatgac
atgaatgagccgtctgtatttggagggccggaacagacaatgccgaaggatgcggtgcat
catggcggtgtggagcatcgggaactccacaacttgtatggcttttaccagcacctggct
acagtggaagggttgatctcacgatcaggtggccttgagagaccctttgtgctgtcccgt
tctttctttgccgggtcgcaaaggcttggtgcggtgtggacaggggacaatctggccacc
tgggagtacctaaagatctccatcccaatgctcctgtccctgagcattgtgggtgtggcc
ttctgtggggcggacgtgggtggatttttccaggacccgaagccagagctgctgatccgc
tggtaccaggcggggtcactgcagcccttcttccggggtcactcggccaaaatgatgaag
cgccgggaaccctggctctttggggacaccgtcaccgctgcaatccgcaacgctgtacag
cagcggtactgcctgctgccctattggtacacactctttcaccaagcgcacacctccgct
aagccccccattagacctctgtgggtggagttctctaaggagcaggacaccttcactgtg
gagcacgagtacatgataggaagtgccttgctggcctgccctgtgacagaccctggagcc
acaaaggtcaaagtattacttcctgggtctggtgagaactggtatgatgtccaaacgaag
cggatctacagcggtggcaggacgttgagccttgctgtcactctggatacagtgcccttg
tttcagcgtggaggcacagtgattcccaggagaacaaagcctggctcttgttcagctgac
ctccagaaaatgcctttctccctcactgtggctctggactccaatgggtgtgcagagggc
tacctgtacttggatgatggacactccttcaactaccgtgacaagaagcactttgcactt
aggaggttctctttgcagaagggccatctgaagtgttgctgcacagataacactgggcag
tttgactcgggatgcttggtgcagtcagtcaccttcctgggagtgaagaagaagccatct
gctgtgacaacacttctctctgaagtggaagagatctgctgtacagtccagtaccaggaa
gaccagcatttgctgatggtgggaaatctcagtctgccagtagggaaggactgggacatg
tggatacgctag

DBGET integrated database retrieval system