KEGG   Scleropages formosus (Asian bonytongue): 108919811Help
Entry
108919811         CDS       T04919                                 

Gene name
tmprss9
Definition
(RefSeq) LOW QUALITY PROTEIN: transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sfm01002]
    108919811 (tmprss9)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     108919811 (tmprss9)
Peptidases [BR:sfm01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108919811 (tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Ldl_recept_a Trypsin_2 SEA DUF1986
Motif
Other DBs
NCBI-GeneID: 108919811
NCBI-ProteinID: XP_018583608
UniProt: A0A1W4Y5W0
LinkDB All DBs
Position
Unknown
AA seq 794 aa AA seqDB search
MEAKKDAEGAARNRSSPTCSSMCCKSIALAFFFIFLIIGLFAGLLIAYLKQEEYNFMETV
ELKGLKYNSSLQDQTAAFPILLSNVLNTKIKHVFLASTVAEHFVSSNIVMYGNVNDNVMA
AITLTFKMSKAEKYSADFIQDVMRAGLDSFFNGRTLVIPQFGEISAIILHGASGKSFYNI
GNREATCPENTFPCDNGQCITKPNPECDFLQDCADASDESHCNCGTRPAMSSRVVGGVDT
RGGELPWQQVEEVSLRLRGQHACGASIVNEKWLVSAAHCFERDNDPKDWTALVGATLLSG
TETESRLINITTVIVSPNYDPETTDSDVSVLELETALTFGPYIQPICLPSPSHIFSQGQE
CVVSGWGALHQFSFELPSALQKAVVKIIDLGVCNGTAVYKGAITNNMLCAGFLQGKVDAC
QGDSGGPLVCEDAPGRFFLAGVVSWGVGCAMVNKPGVYSRVTRLRSWILIHTSPSLGPPA
PVAPATPMTTPTCLVFFFVAINCSGNFHCGAGVCVGKVNPECDGVIDCANKADEMNCDCG
SRPAVGPQRIVGGVAARRGEFPWMGSLQHQRSHRCPLAACTRTSTPHCCAALPAFHPKRI
LLCLTYSDPNPAGWTVSLGSVIRSGVGALVIPIQRVILHPGYNSTNMDLDVALLELSVPA
PQSYTIRSVCLPSPVHSFLKTADCYIGGWGSFKEGGTLTNLLQKAQLEIIDQPECQQAYG
NGLTPNMLCAGFMEGGRDTCMGDSGGPLMCQEPSGRWFIAGVTSWGRGCGRTGFPGVYVR
VTAIREWISQHLPF
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgaagaaggatgcggagggtgcagcacggaatcgatcatctcctacctgctcc
tccatgtgctgcaagagcattgccctggctttcttcttcatcttcctcatcattgggctg
tttgcgggactcttgattgcatacctaaagcaagaggaatacaatttcatggagaccgtt
gagttgaaaggactcaaatataattccagtctgcaagatcagacggctgcgtttcccata
ttgctctccaacgtgctgaacacaaagatcaaacatgtttttctggcttcaactgtagca
gaacattttgtgagcagtaacattgtaatgtatgggaatgtcaacgacaatgtgatggca
gccatcacgctgaccttcaagatgtccaaggcagagaagtactctgctgacttcatccag
gatgtcatgagagcaggcctagattctttcttcaatgggcgtaccctggtgattccacaa
tttggggagatcagcgctatcattttgcacggggccagtgggaagtcgttctataatatt
ggaaatagagaagccacctgtccggagaatacttttccttgtgacaacgggcagtgcatc
acaaaacccaaccctgagtgcgacttcctgcaggactgtgctgatgcttctgatgagtct
cactgcaactgcggaacacgtcctgccatgagcagccgtgtggtgggcggcgtggacacc
cgtggaggggagctgccgtggcagcaggttgaggaggtcagtttgaggcttcgtggccag
cacgcctgcggggcttccatagtcaatgagaaatggctggtcagtgctgcccactgcttt
gaaagagacaatgacccaaaggactggactgccctggtgggggccactctgttgagcggg
acagagacggagtccaggctcattaacatcacaaccgtcattgtgtcgccgaattatgac
ccggagaccaccgacagcgacgtgtccgtgctggagctggaaaccgccctcaccttcggc
ccttacattcagcccatctgcctgccctccccctcccacatcttcagccagggccaggag
tgtgtagtgtctgggtggggggctctccatcagttcagcttcgagctgccatctgctctt
cagaaagcggtggtgaagatcattgacttgggcgtgtgcaacgggaccgctgtgtacaaa
ggagccatcaccaacaacatgctgtgcgctggctttctgcagggaaaggtggatgcctgt
cagggggactccggaggccccttggtttgcgaggatgcccctggacgcttcttcttggcg
ggagtggtgagctggggagtgggctgtgctatggtcaacaagcctggggtgtactcgcgt
gtcacgaggctgcggagttggatcctcatccacacttcgcccagcctgggtcctccggcg
ccggtagcacctgctacgcccatgactacgccgacctgtcttgtgtttttttttgtagcc
ataaactgtagcggtaacttccattgcggtgcgggtgtatgcgtgggcaaggtcaaccct
gagtgtgacggggtcatcgactgtgcaaacaaagctgatgagatgaactgcgactgtggg
agtcgaccggcggtggggccccagaggatcgtgggcggcgtggcggcacggaggggtgag
ttcccatggatgggcagcctgcagcaccagcgctcccaccgctgcccactggctgcctgc
acccgcacctccaccccacactgctgcgccgctctgcctgcatttcacccaaaacggatt
ctgctctgcttaacatacagcgatcccaaccctgctggctggaccgtcagcctgggctcc
gtgatccgctcgggtgtaggcgctttggtcatacccatccagagggtcatcctacacccg
ggctacaacagcaccaatatggaccttgacgttgccctgctggagctatcagtcccagcg
ccacagtcctacaccattcggtcggtctgcctcccctcccccgtgcacagcttcctgaag
acagcagattgctacattggcggctggggttctttcaaggaagggggaacgctgaccaac
ctcctgcagaaagcccaactcgagatcatcgatcagcccgagtgccagcaagcctatggc
aacgggctaactcccaacatgctgtgtgcagggttcatggaaggtggcagagacacgtgc
atgggagactctgggggacctctgatgtgccaggaaccgtcaggccgctggtttattgcc
ggggtcaccagctggggtcgtggatgtggacggactggcttccctggggtttacgtgcga
gtcactgccattagagagtggatatcccagcacctgcctttctaa

DBGET integrated database retrieval system