KEGG   Scleropages formosus (Asian bonytongue): 108919946Help
Entry
108919946         CDS       T04919                                 

Gene name
polrmt
Definition
(RefSeq) DNA-directed RNA polymerase, mitochondrial isoform X1
  KO
K10908  DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sfm03029]
    108919946 (polrmt)
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     108919946 (polrmt)
Mitochondrial biogenesis [BR:sfm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    108919946 (polrmt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol RPOL_N PPR_2 PPR_3
Motif
Other DBs
NCBI-GeneID: 108919946
NCBI-ProteinID: XP_018583890
UniProt: A0A1W4Y606
LinkDB All DBs
Position
Unknown
AA seq 1237 aa AA seqDB search
MFAEMPRTVFRRNYSPLIPKKEDDRMRVWKQHQLLDVLEARIQQLQSDGILDVKQAEVQL
LKVPQGVEGCSAPKGVKKVPKCAADAAKEGEAVDVALLKTYPSRWIEKLKKEKNRMGKKV
HVQQNAPQNPATIAAEPESLKRPSTTFKTISKSKKSKVVKKPAHPRPVAPPSKGAQEKVP
DEVPALSVNVLKDFELEESTPKPPLGVGKDSRCGDTQLNLCCYLEACVASGNVDRAQRCL
FYHHRHILRRKLLSISAYNTMMRLWAKKGSLSQIGRLFVMVEEAGLKSNLRTYQAALECM
GRNQSCSPRVIARCLQQLKKDGFSLDDLFRQCAFRQDEQEMVLKAVQTVEPGFQPSTDVA
HRICSSPLVQDFYSQRDEVRFPKLDFSLAELQERFGHQLRMEQATTITIDSVEASKSITD
HQAKMRELLEGVRSRWQKDLLQALKDSKVILAHSGKKSGKMNLYPYLCLLDDQEYVDIML
QGLSEVPPNGETLIMFASTLGHKVYNKYIIQQKSRSQMVGKLQNIYDRYAELLAKHSEKC
DVLPREHWVQLEAEMMNCGPSLTSDDTLWPQSLMILLGTHLVDLMVQELKLFSNILNPGE
AKKLIPVLYHMYTFRSNRQVGFIKPHPILIQLLSEAVESKLSFESYVIPMLCPPVPWTSP
KFGAYLLSPTKLMRAEDGAVQHQLLLERCRNEDLHAVLDSLNQLGNCAWQINKPLLDIII
SIFNDKGNEKMKIPPPMSEAPEIPRLSFHSDPLCSSSEQAQLKRDMLKAKKKVAEMHSLR
MSALYALSIANHMRDKVFWFPHNMDFRGRTYPCPPYFNHLGSDVARAILMFAEGKPLGPH
GLDWLKIHLVNLTGLKKRSSLAVRLEYANSIMEDILDSADRPLTGKKWWMNVDEPWQALA
CCMEIAKASRSPDHTRFISHFPVHQDGSCNGLQHYAALGRDVIGATSVNLMPCDEPQDVY
SVVAQQVEEFRACDAEKGEKIAQVLQGFINRKVVKQTVMTVVYGVTRYGGRLQIEKRLKE
TEEFPMEYVWEASHYLVNQVFNSLKEMFTGTREIQDWLTESARLIAKSGNTVEWVTPLGL
PVIQPYHRGKKVLLKSNMQSVHIQVNHDFRERPDTMKQKNAFPPNFIHSLDSTHMMLTAL
YCYRAGLTFVSVHDCFWTHAVTVDTMNRICREQFVALHSQPILQQLSRFLVWRYSTEPPS
ENKKFSEHQKMLQLLSQVPHTGDFDLERVKESTYFFS
NT seq 3714 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcagagatgcctcggacagtgtttcggaggaattattcgccactgatccccaaa
aaggaggatgacaggatgagagtctggaagcagcatcagctgttggacgtgctggaagcc
cggatccagcagctgcagtccgatggcattctggacgtcaagcaggctgaagtgcagctt
ctcaaagttccccaaggtgtcgaagggtgttcggcccccaagggtgtgaaaaaggtaccc
aaatgtgcggcggacgcggcaaaggagggggaggctgtcgacgtagcgctactgaagacc
taccccagccgctggatagagaagctgaagaaggagaagaacaggatgggcaaaaaagtc
catgtgcagcagaacgccccccaaaacccagcaacgattgcagcagagccagagagcttg
aaacgcccaagcaccacttttaaaactatttcaaagagcaaaaaaagcaaggtggtgaaa
aagccagcccatccgaggcccgtcgcgccaccttcgaaaggcgcccaggagaaggtgcct
gacgaggtgcctgctctttctgtgaatgtgctgaaggactttgagctggaggaaagcacc
cccaagccacctctcggggtggggaaggacagccgctgcggcgacacccagctgaatctg
tgctgctacctggaggcctgcgtggcttcgggcaacgtggatcgtgcccagcgctgtctg
ttctatcaccatcgccacatcctgcggcgcaagctgctctccatcagcgcctacaacact
atgatgaggttgtgggccaagaagggctccctgagccagattggccgtctctttgtcatg
gtggaggaagctggtctgaagtccaacctcaggacctaccaagctgcgctggaatgcatg
ggtcgcaaccaaagctgctcaccacgcgtcatcgccaggtgtctgcagcagctgaagaag
gatggcttctccttggatgacctgttcaggcagtgcgccttccggcaggacgagcaggaa
atggtgctcaaggccgtccagacggtggagccaggcttccagcccagcacggatgtggct
caccgcatctgctcctcaccgctggtgcaggacttctacagccagagggatgaggttcgg
ttcccaaagctggacttcagccttgcagagctgcaggagaggtttggccatcagctcagg
atggaacaggccaccaccatcaccattgactccgtggaagcctccaagtccatcactgac
caccaggccaagatgagggagctgctggagggagtgcgctcaaggtggcagaaggacctt
ctacaagctctcaaggacagcaaggtgatcctggcccacagtggcaaaaagagtgggaag
atgaacctgtacccttacctgtgtctgctggatgaccaggagtacgtggacatcatgctg
cagggcctgtctgaagtgccgcccaacggagaaaccttgataatgttcgccagcaccctg
ggccacaaggtctacaacaagtacatcatccagcagaagagccgcagccagatggtggga
aagctccagaacatctatgacagatacgcagagctgctggccaagcacagcgagaaatgt
gacgtgttgcctcgagagcactgggtgcagctggaggcagaaatgatgaattgtgggcca
tccctcaccagtgatgacactctgtggccccagagcctcatgatccttttgggaactcac
ttggtggacctcatggtgcaggagctgaagttgttcagcaacattctgaacccgggcgag
gcaaagaagttgatccctgtgctgtaccacatgtacaccttccgcagcaaccgacaggtt
ggattcatcaagccccaccctattttgattcagctgctatcagaggctgtggagagcaag
ctgagctttgaatcatacgtcatacccatgctctgcccccctgtgccctggacttcacca
aaatttggggcttacctgttgtctcccaccaagcttatgcgtgcagaggacggggccgtc
cagcaccagctcctcttggagaggtgccgtaacgaggaccttcacgccgtgctggactcc
ctcaaccagctgggcaactgtgcctggcagatcaacaagcccctgctggacataatcatc
tctatcttcaacgacaagggcaacgagaaaatgaagataccaccaccgatgtcggaagct
ccggagatacctcgcttgagcttccactcggatccgttgtgctcctcatctgagcaggct
caactgaaacgcgacatgctcaaggccaagaagaaggtggctgagatgcacagcctccga
atgtcggccctatatgcattgtccattgccaaccacatgcgcgacaaggtcttctggttc
cctcacaacatggacttccgcgggcgcacctacccctgcccgccatacttcaatcacttg
ggtagcgatgtggcacgagcaattctgatgtttgcagagggcaaaccactgggacctcat
ggactagattggctcaaaatccacctggtgaacctcacaggtctgaaaaagcgtagctct
ctagccgtcaggctggaatatgctaacagcatcatggaggacatcctggactcggctgac
cgacctctgactgggaaaaaatggtggatgaacgtagatgaaccctggcaagctcttgcc
tgctgcatggagatagcgaaggcctcacgttcccctgaccacacacggttcatctctcac
ttccccgtgcatcaggacggctcctgcaatgggctgcagcattatgcagccctgggccgc
gatgtcattggcgccacctctgtcaacctcatgccatgtgacgagccacaggacgtctac
agtgtagtggcacaacaggtggaggagttccgtgcttgtgacgctgagaaaggggagaag
atcgcccaggtcctgcaaggcttcattaatcggaaggtggtgaagcagactgtgatgact
gttgtctatggggtgacacgctacggggggcgactacagatcgagaagcggctgaaagag
actgaagaattccccatggaatatgtgtgggaggcctcacactacctggtgaatcaggtc
ttcaacagcttgaaggagatgttcaccgggaccagggagatccaggactggctgacggaa
agcgccaggctcatcgccaagtctgggaacacagtggagtgggtgacgcctttgggcctg
ccagtcattcagccctaccaccgtggcaagaaagtcctgctcaagagtaatatgcagtca
gtgcatatccaagtcaaccatgacttcagagaacggccagacaccatgaagcagaaaaac
gccttccctcccaacttcatccactccctggactccacacacatgatgctgaccgcgctg
tactgctacagggccggcctcacgttcgtctctgtccacgactgcttctggacacacgct
gtcaccgtggataccatgaacaggatttgtcgggagcagtttgtagccctccacagccag
ccgatcctacagcagctgtcccgcttcctggtgtggagatacagcaccgaaccaccaagt
gaaaacaagaagttttcagagcaccagaagatgttacagctgctgtcacaggttccccat
acaggggattttgatcttgagagagtgaaggaatcaacatatttcttcagctga

DBGET integrated database retrieval system