KEGG   Scleropages formosus (Asian bonytongue): 108919967Help
Entry
108919967         CDS       T04919                                 

Gene name
uimc1
Definition
(RefSeq) BRCA1-A complex subunit RAP80 isoform X1
  KO
K20775  BRCA1-A complex subunit RAP80
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    108919967 (uimc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108919967 (uimc1)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-A complex
     108919967 (uimc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAP80_UIM Ribosom_S12_S23 Herpes_U47
Motif
Other DBs
NCBI-GeneID: 108919967
NCBI-ProteinID: XP_018583915
UniProt: A0A1W4Y631
LinkDB All DBs
Position
14
AA seq 980 aa AA seqDB search
MPRKKRARPKGREEEDERDVPQKRRHDDDDDADDAEDQTVFIGDSEEEEEEKSRDRKPGM
LDRDYRAQGPEMTEEEMFNLAMKLSEEEAKNTAMQQQQEDEAIKIAIAESLHANGIQPDN
RVPKLVALTMGPGSVLSSDHESFPVPESSVFPARKKSLRFNQSKTLQCSSHRDSVTTVST
RKKKQPNSALTQRSELHLAGQAASSLSSAVSEKEKSFSQKKDPRSQSPHQDVQDASSCQS
QLEGNIFGPMRTSPPHRPIICIAKLSQDLVEDCQATGYILCSQKLSGCLESSQTPTLSQQ
DSPSPSESPTFPRMDLRKDHEVAKSESEGVSQEYLCLETIDDSESLLSRVKTLSLSRRQI
LKEQTPGGKNSSGQQVHAGFFQGGEEVHHRTNVHGHTGEEPFHPLTDENDEFCTQMELHW
SDDDDDDEEEGKALVKNTHRKLKTYLIRGQGSQSAGTGVSCSSDLDLPTSPVFPQDALQS
MGPQGTMPAKGVKSVQEAERKPTAVPSGRALTGTVYPPPVVDGHGSCAVRYYWGVPFCPR
GLDPDNYTRAILTQLEVYEKSLKEARRGLLRKAAWGDPVLPGPAEVPPCRRGRPKRFRAL
RQLPDEDEDDGEDEDEEENEDTTTSELVEVVEVQESTGSPQVSKISEQKMGETQDDDALR
VPSPLSKRENFPMVRKPDFSENLILLRKGYLRCRGSAVTETQEIRDEEEDLCPETELSDE
NTPELMVQSPEQSKVKAAEPECTDLLDEQQVGSGPAQEAGSEQTLQQQQEQEEHVDTGTE
EVHGNPEVMECPICMHAFPLEQIEMHAAYCDGSPEDLPLVEELSTQVRSQRRSSRRVEVL
DDNQPTSSSSGKTQKKERCYICRGTFPISEYERHVDDCLCHRTSAANKGAKNLLVALDQS
EQKGSAGPSDSRWRKRGNSSCSPVDGSEASEEAPTTAFQVRTSPIRAFTPISEITDCLID
FKNQYTAKPSQRRGRRKKFK
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggaagaagcgagcccgtccgaaagggagagaagaagaggatgagagggatgtt
cctcagaagcgacggcatgatgatgatgatgatgctgatgatgcggaggatcagacggtg
ttcattggcgacagcgaagaggaggaagaagagaagtccagggacaggaagcctgggatg
ctggacagggactatagagcccagggaccagagatgacagaagaggagatgtttaacttg
gccatgaagctgagtgaagaggaggcaaaaaacaccgcaatgcagcaacagcaggaagac
gaagccataaagatagccattgctgaaagtctccacgcaaatgggattcaacctgacaac
cgcgttcccaagttggtcgccttgacaatgggcccagggtcagtgctgtcatctgatcat
gagtccttcccagtacctgagagctctgtgtttcctgccaggaagaagtcattgcgtttc
aaccaaagcaagactctccagtgttcttctcacagggacagtgtcactacggttagcact
cgtaaaaagaaacagccaaacagtgctctaactcagagatcagaattgcatctggctgga
caagcggcttcctctttgtcctcagcagtctctgagaaggagaagagtttttcccagaaa
aaagatcccaggtcacagtccccacatcaggatgttcaggatgcttccagctgtcagtca
cagttggaaggcaacatctttggccccatgaggacaagccctccccacagacctatcatc
tgcattgcaaagctgagtcaagacctagtggaagactgccaggccacagggtatatcttg
tgctctcagaagctatctgggtgcttggaaagctcacagacaccaacgttatcccagcag
gacagtcctagtccctcagagagtccgacattccccaggatggatttgagaaaggatcac
gaagtggccaagtctgaatcggaaggggtttcacaggaatatctgtgtctggagaccata
gatgactctgagtccctgttgtctcgcgtgaaaacgctgtctttgagtcggagacagata
ctcaaagagcagacacctggagggaaaaattcttctggccagcaggtccatgctggtttc
ttccaggggggcgaggaagttcatcaccgaacaaatgtacatggccatactggggaggag
ccatttcatccactgacagatgaaaatgacgaattctgcacccagatggagctgcactgg
tcggatgatgatgatgatgacgaagaggagggaaaagctctggtgaagaacacccatagg
aagttaaaaacatatttaatccgcggtcaggggtcccaaagcgctggcactggagtgagc
tgctcctcagatctggatctgcccaccagcccagttttcccccaggatgccctacaatcc
atggggccccaaggcactatgcctgccaagggagtcaagagtgtacaggaagccgagcgg
aagcccactgctgtgccctcaggcagagctctgactggcacagtctacccacccccagtt
gtagacgggcatgggagctgtgcggtacggtactactggggtgtgccgttctgccctcgt
ggcctggacccagacaactacacacgtgccatcctcacccagctggaggtgtatgagaaa
agcctgaaggaggcccgcaggggactcctccgcaaggccgcatggggagaccctgtgctc
cccggacctgcagaggtgcccccttgcaggaggggtcgtccaaaacgtttccgtgccctg
cggcagctaccggatgaggatgaggacgatggggaggatgaagatgaggaggaaaatgaa
gacacgacgacttcagagcttgtggaggttgtggaagtgcaggagagcacagggtctcca
caggtctccaagataagtgaacagaaaatgggagagacacaagacgacgatgccctgaga
gtgccatctccgctgtcaaaacgggagaatttcccaatggtgagaaagccagacttctca
gagaatctcatacttctaaggaaggggtacctcagatgcagaggttcagcagtaacagag
actcaagagattcgggatgaagaggaggacctttgtccagagacagagctgagtgacgaa
aacacaccggagctgatggtgcagagcccagaacagagcaaggtgaaagcagcagagcca
gagtgcacagacctcctggacgagcagcaggtggggagcgggccagctcaggaggctggc
agtgagcagacattgcagcagcagcaggagcaggaggagcatgtggacactggtaccgag
gaagtgcacggcaatccagaggtcatggagtgccccatctgcatgcatgccttccctttg
gagcagattgagatgcacgccgcctactgtgacgggtcccccgaagacctgcccctggtg
gaggagctcagcacccaggtcaggagtcagagaagaagcagtcgaagggtagaagtcctt
gatgataatcagcccacctcctcgtcttctggcaagacacagaagaaagagaggtgctac
atctgcaggggcacattccccatcagtgaatacgagcgacacgtggacgactgtctctgt
cacagaacatctgctgccaacaagggtgcaaaaaatctcttggttgccttggatcagtca
gaacagaaaggatctgctggaccatcggattcaagatggaggaaaagaggaaacagttcc
tgtagccctgttgacggatcagaggccagcgaggaggcaccaaccactgccttccaggtc
agaacttctcctatcagggccttcactccaatctccgagatcaccgactgcctcatcgac
ttcaagaaccaatacacagccaagccaagccaaagaagaggtcggaggaaaaagttcaaa
tga

DBGET integrated database retrieval system