KEGG   Scleropages formosus (Asian bonytongue): 108920123Help
Entry
108920123         CDS       T04919                                 

Gene name
sod2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04068  FoxO signaling pathway
sfm04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108920123 (sod2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108920123 (sod2)
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     108920123 (sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 108920123
NCBI-ProteinID: XP_018584171
UniProt: A0A0P7XJ05
LinkDB All DBs
Position
Unknown
AA seq 226 aa AA seqDB search
MLCRFAGTRRFTAATPLGSALISVVSRQKHMLPDLPYDYGALEPHISAEIMQLHHSKHHA
TYVNNLNITEEKYKEALAKGDVTTQVALQPALRFNGGGHINHSIFWTNLSPSGGGEPQGE
LMEAIKRDFGSFEKMKEKMSAASVAVQGSGWGWLGFDKGSGHLRISACANQDPLQGTTGL
IPLLGIDVWEHAYYLQYKNVRPDYVKAIWNVVSWENVSDRFKAAKK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgcaggttcgctggcactcgaaggttcactgccgccacccccttgggctcggcc
ctgatctctgtggtgtccaggcagaagcacatgctcccggacctgccctacgattatggg
gctctggagccccacataagtgctgagatcatgcagctgcaccacagcaaacatcacgca
acgtacgtcaacaacctcaacatcacagaggagaagtacaaagaagcgctggccaagggt
gacgtgaccacacaggtcgctctgcagccagctctgaggttcaatggtggaggtcacatc
aaccacagcatcttctggacgaacctatcccccagcggtgggggggaaccccaaggggag
ttgatggaggccatcaagcgagactttggttcctttgagaagatgaaggagaaaatgtct
gcagcttcagtggccgtgcagggctctggctggggttggctcggatttgacaaggggagt
ggccacctgcggatttctgcttgtgccaaccaggaccccctgcagggcactacaggcctc
atcccactgcttggtattgatgtgtgggagcacgcctactatctccagtacaagaacgtg
aggcctgactacgtgaaggccatctggaatgtggtcagctgggagaatgtgagcgatcgt
ttcaaggctgcaaagaaataa

DBGET integrated database retrieval system