KEGG   Scleropages formosus (Asian bonytongue): 108920173
Entry
108920173         CDS       T04919                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
sfm04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108920173 (tgfa)
   04012 ErbB signaling pathway
    108920173 (tgfa)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 108920173
NCBI-ProteinID: XP_018584248
LinkDB
Position
21
AA seq 164 aa
MERLIRDVIISSIIISIIGSVFTSAQLQENSTTAPVKYPLAAAVRSHFDDCPRSHEQFCF
HGTCRFLVQEETPACVCHAGFVGMRCEHADLLAVVATNQKQQPVATLLVLCVVGSVMLIL
FCTILHCCRRRGRCVLDSFLSCCADKPSTFLKGGASCCHSETVV
NT seq 495 nt   +upstreamnt  +downstreamnt
atggagcgcttaatccgggatgtgatcatcagcagcatcatcatcagcatcatcgggtca
gtgttcacctccgcacagctccaggaaaattccacaacagccccagtaaaatatcccttg
gcggcggctgttcgctctcacttcgacgactgtccgcgttcccacgagcagttctgtttc
cacggaacgtgccgtttcctggtgcaggaggagactccggcctgtgtgtgtcacgcggga
tttgtggggatgcgatgcgaacatgccgacttgctggctgtggtggccaccaatcagaag
cagcagccagtggccaccctgctggtgctctgtgtggtcggcagtgtgatgctcatcctc
ttctgcaccatcttgcactgttgccgacggcggggtcgctgtgtgctggactcgtttctg
tcctgttgtgctgacaaacccagcactttcctgaagggcggtgcctcctgctgtcattct
gaaacagtggtttaa

DBGET integrated database retrieval system