KEGG   Scleropages formosus (Asian bonytongue): 108920739
Entry
108920739         CDS       T04919                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04012  ErbB signaling pathway
sfm04068  FoxO signaling pathway
sfm04110  Cell cycle
sfm04115  p53 signaling pathway
sfm04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108920739
   04068 FoxO signaling pathway
    108920739
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108920739
   04115 p53 signaling pathway
    108920739
   04218 Cellular senescence
    108920739
SSDB
Motif
Pfam: CDI SCAB-ABD
Other DBs
NCBI-GeneID: 108920739
NCBI-ProteinID: XP_018585261
LinkDB
Position
21
AA seq 207 aa
MLPHLYSAFRQRRTDTVFPLRSRFTWKKIGIIMVLYQLQGNMAGISSESDIAPFSGEEVK
PRLGSVRRNLFGPVDHQQLQQDFQRLLRMSVEEATRRWNFDFQSDRPTPGATEWEELRCQ
DVPAFYRSCMVKSGVGPRAEPPSRGCGGSSPPVGEYLEITARETYRCCEQEKRVSVAATG
KRRQAIITDFFAVKKRRLLHPKGHALQ
NT seq 624 nt   +upstreamnt  +downstreamnt
atgttgccgcacttgtactctgcatttcggcaaagaagaacagatacagtgtttccactt
cggtccaggttcacttggaaaaagattgggatcatcatggttctgtatcaactccaaggg
aatatggcggggatctcctccgaatcggacatcgcgcctttctctggggaggaagtgaag
ccgcggttggggtcggtgcgccggaacctgtttggccccgtggaccaccagcagctgcag
caggatttccaacggctgctccgcatgagcgtggaggaggccaccaggaggtggaacttt
gacttccagagcgaccggccgaccccaggcgccacggagtgggaagagctgcggtgccag
gatgttccggcgttctaccgcagctgcatggtgaagagcggggtggggccaagggcggag
cctccgagcagggggtgcggtggaagcagcccacctgtgggagagtacctggagataaca
gccagggagacgtacaggtgctgcgagcaagagaagcgggtgtctgtcgctgccaccggc
aaacgcaggcaggcaatcattacagacttctttgctgtgaagaagaggaggcttcttcat
cccaagggccacgctctccagtga

DBGET integrated database retrieval system