KEGG   Scleropages formosus (Asian bonytongue): 108920904
Entry
108920904         CDS       T04919                                 

Gene name
cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
sfm04020  Calcium signaling pathway
sfm04260  Cardiac muscle contraction
sfm04261  Adrenergic signaling in cardiomyocytes
sfm04270  Vascular smooth muscle contraction
sfm04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108920904 (cacna1c)
   04020 Calcium signaling pathway
    108920904 (cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108920904 (cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108920904 (cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    108920904 (cacna1c)
   04270 Vascular smooth muscle contraction
    108920904 (cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sfm04040]
    108920904 (cacna1c)
Ion channels [BR:sfm04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108920904 (cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 108920904
NCBI-ProteinID: XP_018585503
LinkDB
Position
21
AA seq 2170 aa
MVNESKNMYIPEENLENHQGSNYSSPSLAPPASLNDREHTVVGLAPEHVPTPGAALSWQA
AIDAARQAKLMGNAGAPISTASSTQRKRQHYGKPKKQASTAATRPPRALLCLTLKNPIRR
ACISIVEWKPFEIIILLTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAF
LKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKWEGATPIGGKAAGFDVKA
LRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMH
RTCFHFRDGVLGTLAEEKPAPCAPPHVNGRHCTPQNTTKCEMGWAGPNDGITNFDNFAFA
MLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKER
EKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGMDEEKPRNLSMPASENE
SVNTDNAPAGDMEGETCCTRLANRISKSKFSRYSRRWNRLFRRKCRAAVKSNLFYWLVIF
LVFLNTLTIASEHHKQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFD
SFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIA
SLLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWNSVMYD
GIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKE
RKKLARTASPEKRQDNEKQPIEEEQKEEKIELRSITSDGETPTATKINIDEFQGDENEEK
NPYPANDFPGEEDDEEPEMPVGPRPRPLSDIQLKEKAVPMPEARAFFIFSHTNKFRVLCH
KIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNKILGYADYVFTGLFTIEIILKMTA
YGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKG
LKHVVQCVFVAIRTIGNIVIVTSLLQFMFACIGVQLFKGKFYSCTDNSKQTEAECKGSYI
LYKDGDVAKPEKSQRLWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDIGP
IYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYAL
KARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFILILLNTICLAMQHHGQSGSFNKAMNVL
NMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINPADSTSSSQS
TMVRPMGLQNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALL
IVMLFFIYAVIGMQMFGKIALRDNSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACA
PMRPCENGSEEGPASEDCGSHFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSIL
GPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMP
LNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAG
DDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQAGLRTLHDIGPEIRRAI
SGDLTVEEELEKAMKETVCAASEDDIFRRAGGLFGNHVNYYHQTDGRNTFPQSFTTQRPL
HISKSGSPGDGESPSHEKLVDSTFTPSSYSSSGSNANINNANNTAIGRFPSPSISTVDGH
RGAPLTPVLLPRPAWHFPAKSSDSSDSRLPIIRREEASIDETYDETFVDEREYHSNQDML
SSEMLAYQDEESKQLAPMEEGEDTGERRSWQSPRRAFLCPTALARRSSFHLECLKRQART
DGSQRTALPLHLVHHQALAVAGLSPLLRRSHSPTLFSRLCSTPPDSPSTRGGRPYQPTPT
LRLEADGSFEKLNSSLPSVNCGTWYSDSNGNGSQTRLRPPRPVSLAVPSMLGKDSTQLCH
GSAGSLVEAVLISEGLGHYAQDPSFIEVTKQELADACDMTIEEMETAADNILNGNSQPSP
NGNLLPFIHCRDHGVPGPSQTEGPTGAIGGQREELGVDIMKEEEQVEEQEVSRDCGFLDN
DEDMDCVTSL
NT seq 6513 nt   +upstreamnt  +downstreamnt
atggtaaatgaaagcaaaaacatgtacataccggaggaaaaccttgaaaaccatcaaggc
tccaactactcgagcccgtctctggcacctccggccagcctgaacgaccgtgaacacacg
gtagtggggctggccccggagcacgtccccacgccgggggccgcgctgtcctggcaggcg
gccatcgacgcggcgcggcaggccaagctgatgggcaatgctggcgcccccatctccaca
gccagctccacgcagcgcaagcgccagcactacggcaagcccaagaagcaggccagcacg
gcagccacacgcccgccccgtgctctcctctgcctcaccctcaagaaccccattcggcgg
gcctgtatcagcatcgtagagtggaaaccctttgaaataataattttgctgactattttt
gctaactgtgtggccttagctgtctacatcccctttcctgaggacgactccaatgccacc
aactccaacctggaacgggttgagtatctcttcctcatcattttcaccgtggaggcgttc
ctgaaggtgatagcctacggactgctcttccatcccaacgcatacctgcgcaacggatgg
aacctgctggatttcatcattgtagttgtaggactttttagtgctattttggaacaagcc
accaaatgggaaggggcgacgcccatcggagggaaggcggcaggcttcgacgtgaaggca
ttgcgagcgttcagggtgctcaggccgctgcggctggtgtccggggtgcccagcctccag
gtggtgctcaactccatcatcaaagccatggtacccctgctgcacatagccctcctcgtc
ctcttcgtcatcatcatctacgccatcatcggcctggaactgttcatgggcaagatgcac
cggacgtgtttccattttcgggacggggtcctgggcaccctggcggaggagaaacctgcc
ccttgtgcccccccgcatgtcaatgggagacactgcacccctcaaaacaccaccaagtgt
gagatgggctgggcggggcccaacgatggaatcaccaacttcgacaactttgcgttcgcc
atgttgacagtctttcagtgtatcaccatggaaggctggactgacgtgctctactggatg
caagacgcaatgggctatgagcttccctgggtgtactttgtcagtttggtcatcttcgga
tcctttttcgtactaaatctagttctgggggtgttgagcggggagttctccaaggagaga
gagaaagccaaggcacggggggacttccagaaactgcgagagaagcagcagcttgaagag
gacttgaagggctacctggactggatcacccaggccgaggacatcgaccctgagaatgag
gaggaaggaatggatgaggagaagccaagaaacctgagcatgcctgccagcgagaacgag
tcggtcaacactgacaacgctccagctggggacatggagggagagacctgctgcacccgt
ctggcaaataggatctccaaatccaaattcagccgctactcgcggcgctggaaccgtctg
ttccggcggaagtgccgtgcggctgtcaagtccaacttgttctactggctggtgatcttc
ctggtcttcctgaacacactcaccatcgcctccgagcaccacaaacagccccagtggctg
acggacgtgcaagacatcgccaacaaggtgctgctggcgctgttcactggcgagatgctg
ctgaagatgtacagcctgggtctgcaggcctatttcgtgtcgctcttcaaccgctttgac
agctttgtggtgtgcggtggcattctggagaccattctagtggagaccaagattatgtcg
ccacttggcatctccgtgctccgctgtgtgcgtctgctgcgcatcttcaagatcaccagg
tactggaactccctaagcaacctggtggcctccctgctcaactcagtgcgctctattgcc
tccctgctgttgctgctcttcctcttcatcattatattctccctgctgggcatgcagctg
tttggaggaaagttcaacttcgatgagacccgccgcagcaccttcgacaacttcccacag
tcgttgctcaccgtcttccagatcctgacaggcgaggactggaattcagtaatgtatgat
ggcatcatggcatatggtggcccctcattcccaggcatgcttgtctgcatctacttcatc
atcctcttcatttgcgggaactacatcctgctgaatgtcttcttggccatcgctgtagac
aatcttgcggatgcagaaagtttgacatcggctcagaaggaggaagaggaagagaaagaa
aggaagaagctggcaagaactgctagtccagaaaagcggcaggacaacgagaaacagcca
atagaggaggaacagaaagaagagaaaattgagttgagatccattacctcagatggtgag
acaccaactgcaaccaagattaacattgatgaattccaaggggatgagaatgaagaaaag
aatccatatcctgcaaatgatttcccaggagaggaagatgatgaggagccagagatgcca
gtggggccccgtccccggccactctcagacatccagctgaaggagaaggctgtccccatg
cctgaggctcgggccttcttcatcttcagccacaccaacaagttcagggttttgtgccac
aaaattgtcaaccacaacatcttcacaaacctcatcttgttcttcattctactgagcagc
atctcattggctgctgaagaccctgtgaagaatgattccttcaggaataagatactgggc
tatgccgattacgtctttacaggactgttcacgatcgagatcatcttgaagatgacagct
tatggagcattcctccacaaaggctccttctgccgcaactacttcaacatcctggatctg
gtggtggttagcgtgtccctcatctcctctgggatccaatcaagtgccattaatgtagtg
aagatcctcagggtactgcgagtgctgaggccactgagggcgatcaaccgagccaagggc
ctcaagcacgtggtccagtgtgtctttgtggcgatccgcaccatcgggaacatagtgatc
gtcacctccctcttacagttcatgtttgcctgcatcggagtgcagctcttcaagggcaag
ttttacagctgcactgacaactccaaacagacagaagctgaatgcaagggttcctacatc
ctctacaaagatggagatgtagccaaacctgagaagtctcaacggctctgggagaacagt
gacttcaactttgatgatgtgcttcaaggcatgatggcactcttcgcagtctccaccttt
gagggttggccagggctgctgtacagggctatagactctcatgcggaagacattggaccc
atctacaactatcgcgttgtgatctccatcttcttcatcatctacatcatcatcatcgcc
ttcttcatgatgaacatctttgtgggtttcgtcatcgtcacatttcaggagcagggcgag
caggagtacaagaactgtgagctagataagaaccagcgccagtgtgtggagtatgcactg
aaagctcgcccactacgaaggtacattcccaagaacccctaccagtataaagtgtggtat
gtggtgaattccacctacttcgaatacctgatgttcatcctcattctgctcaacaccatc
tgtctggccatgcagcatcacggccagtctggatccttcaacaaggccatgaacgtgctg
aacatgctcttcactggcctcttcactgtggaaatgatcctcaagctcatcgccttcaag
cctcggggttactttagtgatccttggaatgtatttgacttcctcatcgttattggcagc
ataatagacgtcattctgagtgagatcaatccagctgactccacctcgtcttctcaatcc
accatggtaagaccaatgggactgcaaaacacggaggacaatgccaggatttccataacc
ttcttccggctcttccgcgttatgaggctagtgaagcttctgtctcgaggagagggcatc
cggaccctgctctggaccttcatcaagtcctttcaggcactaccctatgtagccctgtta
attgtcatgctgttcttcatctatgctgtaattggaatgcagatgtttggtaagattgct
ctccgggacaacagccaaatcaatcggaacaacaacttccagacattcccacaagccgtc
ctcctgcttttcaggtgcgcaacaggggaggcgtggcaagagatcatgcttgcgtgtgct
ccaatgaggccgtgcgagaacggctccgaggaggggcctgctagcgaggactgcggcagc
cactttgccatcatctattttgtcagcttctacatgctgtgtgcctttttgatcattaac
ctgtttgtggcagtcattatggataactttgattacctgacgcgggactggtccattctg
gggccgcaccaccttgacgagttcaagaggatctgggcagaatacgaccccgaggccaag
gggaggattaagcacctggatgtggtgacactgctgcgcagaatccagcctcccctgggc
tttggcaaactatgcccccatcgcgtggcctgcaagcgactggtgtccatgaatatgcca
ctgaacagtgatgggacagtcatgttcaacgctactctgtttgccctggtgagaactgca
ctgcgcatcaagacagaaggtaacttggagcaggcaaatgaggagctgcgggcaattgtg
aagaagatctggaagaggaccagcatgaagctgctggaccaggtggttccacctgcagga
gatgatgaagtgaccgtgggaaagttctatgccacctttttgatccaggagtatttcagg
aagttcaagaagcgcaaagaacagggtctggtggccaaagttccaccaaagacagccctt
tcactgcaggcgggactgcgaacccttcatgacattggcccagagatccgcagggccatc
tcaggggacctgacggtggaagaggagttggagaaggcaatgaaggagactgtgtgtgct
gcctcagaggatgacatcttcaggcgggcaggtggactctttggcaatcacgttaactac
taccatcaaaccgatgggcggaacacctttccacaatccttcaccactcagcggccgctc
cacattagcaagtcgggcagtcctggcgatggagagtccccatcccatgagaaacttgtg
gactccaccttcacgcccagcagctactcctcctcgggctccaatgccaacatcaacaat
gccaacaacactgccatcggccgcttccccagcccatccatcagcaccgtggatggccac
cgcggggcaccgctcacgcctgtgctgctgccacggcctgcgtggcattttcccgctaag
agctcggactccagcgacagccgcctgcccatcatccgcagggaggaggcgtccatagac
gagacatacgatgagacctttgtggatgagcgggagtaccacagtaaccaagacatgctc
tcctctgaaatgctggcatatcaggacgaagagagcaagcagttagcccccatggaggaa
ggtgaggacacgggtgaaaggcggtcctggcagtcccccagaagggccttcttgtgtccc
actgcactagcccgacggtcttccttccacctggagtgtcttaagcggcaggcgagaaca
gacggctcccagaggacagcgctgcctctgcacctcgtccaccatcaggccctagcggtg
gcaggcttgagccccctgctccggcgaagtcactccccaacgctgttctcccggctatgc
tccactccgcctgacagcccaagcacccggggtggccggccgtaccagcccacgcccaca
ttgcgactggaggccgatggctcatttgagaagctcaacagcagcctcccctcagtcaac
tgtgggacctggtacagtgacagcaacggcaacggtagccagaccaggctgcggccacca
cggcccgtctccctggctgtgccgtccatgctgggaaaggactccacgcaactgtgccat
ggtagtgctggcagtctggtggaggcggtgctgatatcagaaggcctcgggcattatgca
caagacccctcctttattgaggtgaccaagcaggagttggctgatgcctgcgacatgacc
atagaggagatggagaccgccgccgacaacatccttaacggcaacagtcagcccagcccc
aacggcaaccttctccctttcatacactgcagggaccacggtgtcccagggcccagccag
actgaagggccaacgggggctattggggggcaaagggaggagctaggtgttgacattatg
aaggaggaagagcaagtagaggaacaagaggtgtcacgggactgtgggttcttggacaat
gacgaagacatggattgcgtcaccagtttgtag

DBGET integrated database retrieval system