KEGG   Scleropages formosus (Asian bonytongue): 108920955
Entry
108920955         CDS       T04919                                 

Definition
(RefSeq) G/T mismatch-specific thymine DNA glycosylase-like
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108920955
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108920955
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     108920955
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     108920955
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-GeneID: 108920955
NCBI-ProteinID: XP_018585619
LinkDB
Position
21
AA seq 453 aa
MEENQFASLRKAADCPPRWFPSIQHMQALQAHYQQMASIAPIVSGPMEQRMAGEQPAHQE
PRVQEDVAAPAPAKAPAKGKRGRPANKEPKSEGEPEPKVKAGPKPKAAPKAKTEPKGKPG
PKPKKAKEDASSGKQEKIDEAFKKVKRKVDRFNGMTEAEVMTKTLPDILTYNLDFVIIGI
NPGLMAAYIGRWFPGPGNHFWKCLFMSGISEVQLNHMDDQMLPEKYGIGFTNMVQRATPG
SKDLTSKELREGGKILVEKLKKYKPLIAVFNGKCIYEMFCREIFGSKPKNLEFGLQPLKA
PDTETLLYLMPSSSARCAQFPRAQDKVHYYIKLKELRDQIKGVVRSQDIEEVRYTFDLGM
AKEEAKKMAIKEEQYDPGYEAAYGGAYGEPGPDPEQSNGHCSFASAAGSDISSKDAGTAT
TVGQVLDGQWMMQSFADQIPDIGGNSNSGCGGT
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggaagaaaaccagtttgcgtctttgaggaaagctgcggattgtcctccacgctggttc
ccttctatccagcacatgcaggctctccaggctcattaccagcagatggctagcatcgct
ccgattgtgtctgggccgatggagcagaggatggcgggagagcagccagcgcaccaggag
ccccgtgtccaagaggacgtagccgccccagccccggcgaaagctccggctaaggggaag
cgaggaaggcctgcaaacaaggaacccaagtctgagggggagcctgaacccaaggtcaaa
gcaggacccaagcccaaggcagctcctaaagctaaaacagaacctaaaggcaaaccaggc
cccaagccgaagaaggccaaggaggacgcgagcagtggaaagcaggagaagattgacgag
gctttcaagaaggtcaagaggaaagtggaccgctttaacggcatgactgaagctgaagtc
atgaccaaaaccctgcctgacatcctcacatacaacctggattttgtgattataggaatc
aacccaggtctgatggcagcctacattggccgatggtttcctggtccaggaaaccatttt
tggaaatgtctgttcatgtctggtattagtgaagtacagctcaaccacatggatgatcag
atgctacctgaaaagtatggaatagggtttacaaacatggtgcagagggccacaccagga
agcaaagatctgacaagtaaagagttgcgtgaagggggcaaaattcttgtggaaaaactg
aagaaatacaaaccactcatagctgtcttcaatgggaagtgtatctatgaaatgttctgt
agggaaatctttgggtccaaaccaaagaatcttgaatttggcttgcagcctctgaaggct
ccagacaccgaaacgctactctatctgatgccttcatcaagcgctcgctgtgcgcagttc
ccacgtgcccaggacaaggtgcactactacatcaaactgaaggagttgagggaccaaatc
aagggtgtggttcgcagccaggacatagaagaagttcggtacacctttgatttgggcatg
gctaaagaggaggccaaaaagatggcaatcaaggaggagcagtacgacccagggtacgag
gcagcatacggtggggcgtacggagagccggggcctgatccagaacagagcaatggccac
tgcagctttgcctccgctgcagggagcgatatatccagcaaggatgctgggaccgcaaca
acagtgggtcaggtcctagatggccagtggatgatgcagtcatttgcagatcagatccct
gacatcggtggcaacagtaatagtgggtgcggcggtacataa

KEGG   Scleropages formosus (Asian bonytongue): 108920957
Entry
108920957         CDS       T04919                                 

Definition
(RefSeq) G/T mismatch-specific thymine DNA glycosylase-like
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108920957
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108920957
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     108920957
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     108920957
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-GeneID: 108920957
NCBI-ProteinID: XP_018585620
LinkDB
Position
21
AA seq 432 aa
MEENFYSALTVPTDYLQHWYQSNQHVQALQATQYQQMPSMAHFMEGSLEDRVMTELAVHQ
DSPAHREPSFGSELPVYQESAFSCEPAAHNQPSFSCEPPLHQESPVYQEPTVAVSVQTPT
KGKRGRPPNKPKDSNQEEVEEGLKKVKRKVDRFNGMSVDEVMAKTLPDVLAYNLDILIIG
INPGLMSAYIGHHYPNPGNHFWKCLFMAGLTDEQLNYMHDQILPEKYGIGFTNMVERTTP
GSKDLSSKEFREGGRLLVEKLKKYRPLIAVFNGKCIYEIFSKEVFGIKTKTLEFGLQPHK
VPGTDTVCYLMPSSSARCAQFPRAQDKVHFYIKLKELRNQLRGVVRNPDVLETKYTFDLN
LAKEDAKRMAIKEEQYDPGYEDFSGAYGELGPGAGQSKSRACNGIAPSAVMGQNMEGQWN
MQPNQIRAQQHQ
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggaagaaaatttttactcagctctgacggtccctacggactatcttcaacactggtac
cagtccaaccagcatgtgcaggcactccaggccactcagtaccagcagatgcccagcatg
gctcattttatggagggctccttggaggacagggtgatgacggaattggctgtccaccag
gactcccccgcccatcgagaaccctctttcggctctgagctcccggtctaccaggagtcc
gctttcagctgcgagcccgctgcccacaatcaaccttctttcagctgcgagcctcctctg
caccaagagtccccagtctaccaggagcctacagttgccgtctcagtgcaaactcccacg
aaaggaaagagaggaaggcctcccaataagcccaaagacagcaaccaagaagaggttgag
gagggtttaaaaaaggtcaagagaaaagtggaccgcttcaatggcatgtcagtggatgaa
gtcatggccaaaacccttcctgatgttcttgcctataacctggacattttgattattgga
attaaccccggactgatgtcagcctatataggacatcattacccaaatccaggaaaccat
ttttggaagtgcctcttcatggcaggattaacagatgaacagctcaattacatgcatgac
cagattctgcctgagaaatacggtataggattcacaaacatggtggaaaggaccacacca
ggaagtaaagatctgtcaagcaaggaatttcgagaaggaggaaggcttttggtagaaaag
ctgaagaaatacagaccattaatagctgtattcaatggaaaatgtatttatgagatattc
agcaaagaggtctttggaattaagacaaagacccttgagtttggattacagcctcacaag
gtgccagggacagacactgtgtgctacctgatgccctcctcgagtgctcgctgtgcccag
ttcccacgtgcccaggataaagtgcacttctacatcaagctgaaggagctacggaaccag
ctaagaggcgtggttcggaacccagatgttctggagacaaagtacacatttgacctcaac
ttagccaaagaggatgcaaagagaatggcaatcaaggaggaacagtatgacccgggttac
gaggatttctctggagcgtatggagaattaggacctggagctgggcaaagcaaaagccgt
gcttgtaatggaattgcaccctcagcagttatgggccaaaatatggagggtcagtggaat
atgcagccaaatcagatacgagctcaacaacatcagtag

DBGET integrated database retrieval system