KEGG   Scleropages formosus (Asian bonytongue): 108922141Help
Entry
108922141         CDS       T04919                                 

Definition
(RefSeq) DNA (cytosine-5)-methyltransferase 3A isoform X1
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00270  Cysteine and methionine metabolism
sfm01100  Metabolic pathways
Module
sfm_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    108922141
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108922141
   03036 Chromosome and associated proteins [BR:sfm03036]
    108922141
Enzymes [BR:sfm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     108922141
DNA replication proteins [BR:sfm03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    108922141
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108922141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADD_DNMT3 DNA_methylase PWWP
Motif
Other DBs
NCBI-GeneID: 108922141
NCBI-ProteinID: XP_018587595
UniProt: A0A1W4YGM4
LinkDB All DBs
Position
15
AA seq 951 aa AA seqDB search
MMPSNITAPATATSLKTSDSSCDSGGNRMRGDGMDKNLTQEESLADAGPTRTLGRPGRKR
KQHLIDTCSLLKESASGAKSHMGVERKTQAQMHNGDLDSHDNVNTTRKQNGKAPENGVPK
KAAGEGKDHPGEGALKKGQVASSVENGHVSHLDQDSDVKGQQGMSVPRKKRGRRKLEHPE
KYVEETEDSGCETVKAEQGVRGRVRGDLGWEISLRQRPVPRVTFQAGDPYYISKRTRDEW
LARWKMEAEKKARLASAMDTTDESECLKLQKEEETVIPSTPPPQQQQQPTDPASPTVATT
PEPIPAGGGDKAATQAADMDPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRA
AEGTRWVMWFGDGKFSVVCVEKLMPLSSFSNAFHQPTYNKQPMYKKAIYEVLQVASSRAG
KIFRACPDRDDTDTSKSVDMQNKQMIEWAMASFPPTGPKGLEPPEEERNPYKEVYPEAWM
EPEAAAYTSPPPAKKPRKSAAEKPRFKEIIDERTRERLVYDVRQKCRNIEDICISCGSLN
VSLEHPLFSGGMCQSCKDCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVE
CVDLLVGPGAAQAAIKEDPWNCYMCGQQGVFGLLERRSDWPSRLQHFFANNHDQDFDPPK
LYPPVLAEKRKPIRVLSLFDGIATGLLVLKELGIQVECYIASEVCEDSITVGIVRHQGRI
MYVGDVRNVTRKHILEWGPFDLVIGGSPCNDLSIVNPARKGLFEGTGRLFFEFYRLLHEA
RPKEGDDRPFFWLFENVVAMGVSDKRDISRFLECNPVMIDAKEVSAAHRARYFWGNLPGM
NRPLTATSTDKLDLQDCLEHGRTAKFDKVRTITTRSNSIKQGKDQHFPVYMNDKEDILWC
TEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKDYFACI
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgtccaacatcactgctccggccactgccacctccttaaaaacctcagacagc
agctgcgactccggtggcaacagaatgaggggagacggaatggataagaatctcacccag
gaagagagcctagctgatgctggtcccacaaggacacttggccggcccgggaggaaacga
aaacaacatctgattgacacctgcagcttactgaaggagagcgcgtctggggcgaagagt
cacatgggggtcgaaaggaagacccaagcgcagatgcacaatggcgacctggactcccac
gacaacgttaacaccaccaggaagcagaatgggaaggccccggagaatggcgtcccaaag
aaggctgctggcgagggcaaggaccatcccggcgagggagccttgaagaaaggtcaggtc
gcctcctctgtggaaaacggacacgtctcccacctggaccaggactcagatgtgaaaggg
cagcaggggatgtcggtgccacgcaagaaacgaggacgacggaaactggaacaccctgaa
aaatatgtggaggagacagaagacagcggctgtgagactgtgaaggctgagcagggtgtt
cgaggtagggtccgtggggacctgggctgggaaattagcctgcgtcagcggcctgtgccc
agggtcaccttccaggccggtgacccatactacatcagcaagaggacgagggacgagtgg
cttgcaagatggaagatggaggccgagaagaaggccagactggcttctgcgatggacaca
acagacgagtccgaatgtttgaaacttcaaaaggaggaggagactgtaatccccagtacc
ccacctcctcagcagcagcagcagcctacagacccagcatcccccactgtggctacgacc
ccggaaccaatcccggctggaggtggagacaaggccgcgacccaggcagccgacatggac
ccagaatatgaggatggtcgaggcttcgggattggggagctggtgtggggcaagctgcgg
ggattctcctggtggcccggccgcattgtgtcctggtggatgaccggccggagccgagcg
gccgaagggacccgatgggtcatgtggtttggcgacggtaaattctcagtggtatgtgtg
gagaaactgatgcctttaagttccttttccaatgcctttcaccagccaacctataacaag
cagcccatgtacaaaaaagcaatctacgaggtgctacaggtagccagcagccgagctggc
aagatcttccgtgcttgtccagaccgcgatgacacggacacttccaaatcagtggacatg
cagaacaagcagatgatcgagtgggcaatggctagcttcccacctaccgggcccaaaggc
ctggagcccccagaagaggagcgaaatccatacaaggaggtgtacccggaggcgtggatg
gagcctgaggcggcagcgtacacatcacctccacctgccaaaaagccccgaaagagtgcg
gcagaaaagccgaggtttaaagagataatcgacgagaggactcgagagagacttgtttat
gacgtgagacaaaaatgcagaaacatagaagatatctgcatctcctgcggaagtctgaat
gtttccctggagcaccctctcttttccggaggcatgtgccaaagctgcaaggactgcttc
ctggaatgtgcctaccagtatgatgatgacggctatcagtcctactgcaccatttgctgc
ggtggacgtgaggtgctcatgtgtgggaacaacaactgctgccggtgcttctgtgtggag
tgcgtggacctcctggtgggcccaggagcggcgcaggccgccatcaaggaggacccctgg
aactgctacatgtgtggccagcagggcgtctttggcctcctggaacgtcgctccgactgg
cccagccgcctgcagcacttcttcgccaacaaccatgaccaggattttgacccaccgaag
ctttacccacctgtccttgcagagaagaggaagcccatacgtgtcctgtcactctttgat
ggtattgctacaggcctgctggttctgaaggagctgggaatacaagtggagtgctacatc
gcctcagaggtctgcgaggactccatcactgtgggcatcgtgcgccaccagggccgcatc
atgtacgtgggggacgtgcggaacgtgacacgcaaacatattctcgagtggggtcctttc
gacctggtcatcggaggaagcccgtgcaacgacctctccatcgtaaacccagcaagaaag
ggcctttttgaggggaccgggcgtctcttctttgagttctaccgtctcctgcatgaggcg
cgccccaaagagggagatgaccgccccttcttctggctcttcgagaacgtcgtggccatg
ggcgtcagcgacaagagggacatctcccgctttctggagtgcaaccctgtgatgatcgat
gccaaggaagtgtcggctgcccaccgagcacgttatttctggggtaacctccccgggatg
aacagaccactgacagcaacaagcaccgacaagctggaccttcaggactgcctggagcat
ggcaggacagccaagtttgacaaagtgaggaccatcaccacccggtcaaattccatcaag
caaggcaaagaccagcacttccctgtctacatgaacgataaagaggacattctatggtgc
actgaaatggagagggtctttggcttccctgtccattacacagacgtgtccaacatgagt
cggctcgccaggcagagacttctgggacgctcatggagcgtcccggtcatccgccacctc
ttcgccccactaaaagattactttgcctgcatttag

DBGET integrated database retrieval system