KEGG   Scleropages formosus (Asian bonytongue): 108922186Help
Entry
108922186         CDS       T04919                                 

Definition
(RefSeq) trypsin-3-like
Organism
sfm  Scleropages formosus (Asian bonytongue)
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 108922186
NCBI-ProteinID: XP_018587676
UniProt: A0A1W4YH99
LinkDB All DBs
Position
Unknown
AA seq 278 aa AA seqDB search
MALLKKENNNNTGIITKSSYWNVNRLFFYKKLTLRKERLTSPQQLTFPLEGDDDKIVGGY
ECRKNSVPYQVSLNVGYHFCGGSLISNQWVLSAAHCYQSRIQVHLGEHNIAINEGTEQFI
SSSKVIRNPSYSSSTLNNDIMLIKLSQPATLNSYVRTVPLPTSCASAGTMCLISGWGNTL
SSGTNYPDTLRCLDAPILSDTSCRNSYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCNG
QLQGIVSWGYGCAMKNKPGVYTKVCNYKTWIQNTVASN
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcactcctgaagaaggaaaataacaacaacacgggaattatcacaaagtcatcatac
tggaacgtcaacaggttatttttctacaagaaattgaccttgaggaaggaacgcctcaca
tctccacaacagcttaccttccctttggagggtgatgatgacaagattgttggaggatat
gaatgtaggaagaactctgtgccctaccaagtatccctaaatgttggttatcacttctgc
ggagggtctctgatcagtaaccagtgggtcctgtctgcagctcactgctaccagtcccgt
attcaggttcatcttggtgagcacaacattgccatcaatgaaggcaccgagcagttcatc
agctcttccaaggtcatcaggaaccccagctacagcagctccaccctgaacaatgacatc
atgctgattaagctgagccagcctgccactctgaacagctacgtccgcactgtgcccctg
cccacaagctgtgcttctgctggcaccatgtgtttgatctccggctggggcaacaccctc
agtagtggcacgaactaccctgacactctaaggtgcctggacgctcccatcctcagtgac
accagctgcagaaattcctaccctggtcagattacatccaacatgttctgcgctgggtat
ctggagggaggcaaggattcctgccagggtgactctggaggcccagtggtgtgcaatggg
cagctccagggtattgtgtcctggggatatggctgtgccatgaagaacaagcctggtgtg
tacaccaaggtctgcaactacaaaacctggatccaaaatactgttgcttccaactga

DBGET integrated database retrieval system