KEGG   Scleropages formosus (Asian bonytongue): 108922186Help
Entry
108922186         CDS       T04919                                 

Definition
(RefSeq) trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108922186
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sfm01002]
    108922186
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfm04147]
    108922186
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     108922186
Peptidases [BR:sfm01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108922186
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108922186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 108922186
NCBI-ProteinID: XP_018587676
UniProt: A0A1W4YH99
LinkDB All DBs
Position
Unknown
AA seq 278 aa AA seqDB search
MALLKKENNNNTGIITKSSYWNVNRLFFYKKLTLRKERLTSPQQLTFPLEGDDDKIVGGY
ECRKNSVPYQVSLNVGYHFCGGSLISNQWVLSAAHCYQSRIQVHLGEHNIAINEGTEQFI
SSSKVIRNPSYSSSTLNNDIMLIKLSQPATLNSYVRTVPLPTSCASAGTMCLISGWGNTL
SSGTNYPDTLRCLDAPILSDTSCRNSYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCNG
QLQGIVSWGYGCAMKNKPGVYTKVCNYKTWIQNTVASN
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcactcctgaagaaggaaaataacaacaacacgggaattatcacaaagtcatcatac
tggaacgtcaacaggttatttttctacaagaaattgaccttgaggaaggaacgcctcaca
tctccacaacagcttaccttccctttggagggtgatgatgacaagattgttggaggatat
gaatgtaggaagaactctgtgccctaccaagtatccctaaatgttggttatcacttctgc
ggagggtctctgatcagtaaccagtgggtcctgtctgcagctcactgctaccagtcccgt
attcaggttcatcttggtgagcacaacattgccatcaatgaaggcaccgagcagttcatc
agctcttccaaggtcatcaggaaccccagctacagcagctccaccctgaacaatgacatc
atgctgattaagctgagccagcctgccactctgaacagctacgtccgcactgtgcccctg
cccacaagctgtgcttctgctggcaccatgtgtttgatctccggctggggcaacaccctc
agtagtggcacgaactaccctgacactctaaggtgcctggacgctcccatcctcagtgac
accagctgcagaaattcctaccctggtcagattacatccaacatgttctgcgctgggtat
ctggagggaggcaaggattcctgccagggtgactctggaggcccagtggtgtgcaatggg
cagctccagggtattgtgtcctggggatatggctgtgccatgaagaacaagcctggtgtg
tacaccaaggtctgcaactacaaaacctggatccaaaatactgttgcttccaactga

DBGET integrated database retrieval system