KEGG   Scleropages formosus (Asian bonytongue): 108922213Help
Entry
108922213         CDS       T04919                                 

Definition
(RefSeq) trypsin-2-like isoform X1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108922213
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sfm01002]
    108922213
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfm04147]
    108922213
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     108922213
Peptidases [BR:sfm01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108922213
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108922213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 108922213
NCBI-ProteinID: XP_018587706
UniProt: A0A1W4YHC9
LinkDB All DBs
Position
Unknown
AA seq 241 aa AA seqDB search
MKSLIFILLLGVALAEDDKIVGGYECPKHSVPYQVSLNSGYHFCGGSLVNENWVVSAAHC
YKSLIEVRLGEHNIQQTENTEQVISSSSVIRYPYYDSWTIDNDIMLIKLSKPAAFDSYVQ
PVALPEGCAAAGTMCMVSGWGNTMSSTADRNKLQCLEIPILSQKECENAYPGMITSSMFC
AGYLEGGKDSCQGDSGGPVVCDGVLQGVVSWGYGCAEKDHPGVYAKVCEFTQWLKDTMAA
N
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccctgattttcattctgctcctgggagtggccttggctgaggatgataagatt
gttggtgggtacgagtgccccaagcactctgtgccctaccaggtgtctctgaactccggg
taccatttctgcggaggctccttggtcaacgagaactgggtggtgtccgccgctcactgc
tacaagtccctcattgaggtccgcctgggcgagcacaacatccagcagactgagaacacc
gagcaggtcatcagctcctcttcagtgatccgctacccctattacgactcctggaccatt
gacaatgacatcatgttgatcaagcttagcaagcccgccgcgttcgacagctacgttcag
cctgtggctctgcccgagggatgtgccgccgctgggaccatgtgcatggtctctggctgg
gggaacaccatgagctctaccgctgacagaaacaagctgcagtgcctggagatccccatc
ctgtcgcagaaagaatgtgaaaacgcctaccctggcatgatcacctcctccatgttctgc
gctggatacctggagggaggcaaagactcctgccagggtgactctggtggccccgtggtg
tgcgatggggtgttgcagggtgtcgtctcctggggttatggctgtgctgagaaggatcac
cctggtgtgtacgccaaggtctgcgagttcacacaatggctcaaagacaccatggcagca
aactga

DBGET integrated database retrieval system