KEGG   Scleropages formosus (Asian bonytongue): 108922376Help
Entry
108922376         CDS       T04919                                 

Gene name
wbscr17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00512  Mucin type O-glycan biosynthesis
sfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    108922376 (wbscr17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sfm01003]
    108922376 (wbscr17)
Enzymes [BR:sfm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     108922376 (wbscr17)
Glycosyltransferases [BR:sfm01003]
 O-Glycan biosynthesis
  Mucin-type
   108922376 (wbscr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 108922376
NCBI-ProteinID: XP_018587995
UniProt: A0A0P7VNB9
LinkDB All DBs
Position
Unknown
AA seq 601 aa AA seqDB search
MAFVLRRWRMLLVLNVIVVAGFMTFWAKCNSRAVKAGAQDSSADARRLARYNLSAQGASV
SHETLLRRLGSLEDVVYRQLNGLSKSLGLIEGFGGRGQGGLPATLTPEEENDAKYLREKY
GYNAYLSDKISLDRSIPDYRPNRCKKVTYSRDLPQISLIFIFVNEALSVILRSVHSAVNH
TPAHLLKEIVLVDDNSDDEQLKAPLEEYVNKRYPGLIKIVRNQKREGLIRARIEGWKVAS
GEVTGFFDAHVEFTPTWAEPVLSRIKENRKRIILPSIDNIKHETLELERYENSGHGYNWE
LWCMYINPPKQWWDEGDTSAPIRTPAMIGCSFVVNRDYFGELGLLDPGMDVYGGENIELG
IRVWLCGGSMEVLPCSRVAHIARMKKPYHSNIAFHARRNALRVAEVWMDNYKSHVYLAWN
LPMENHGIDYGDISQRVALRKSLQCKNFEWYLNNVYPEMRRYNNTVYYGEIRNTKVSHLC
MDQGVKENHTATLHPCHGWGPQLGRYTMEGQLHLGPLGSTGEDTRCVVDDRLSNLPQMLN
CDKVSSVPHKTWNFSQNESIVNRGTGRCLEVIPANINFGHLLVLQPCTGQRWYIKNTMRL
P
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgttctgagaagatggagaatgttactggtgctgaatgtcattgtggtggcg
gggtttatgactttttgggccaagtgcaactcgcgcgccgtcaaggcaggcgctcaggac
tcctcggccgacgcgaggagactcgcgcgctacaacctgtccgctcagggcgcgagcgtc
agtcacgagaccctgctgaggaggctcggctccctggaggacgtggtctacaggcagctc
aatggcttgtctaagtccctgggtctgatagaaggctttggggggcgaggccaaggtggc
cttcctgccaccttgactcctgaagaggagaatgatgccaaatacctgagggagaaatat
ggttataatgcctaccttagcgacaaaatctccctggacagatccatcccagactaccgc
ccaaacaggtgcaagaaggtaacatactctagagacctgccacagatctctctcatcttc
atcttcgtgaacgaggccctctctgtgatcctgcgctccgtccattcagctgtcaaccac
actccagcccacttgctgaaggagattgtcctggtcgatgataacagtgacgatgaacaa
ctgaaggcacccttggaagagtacgtcaacaagcgctaccctggtctgatcaagattgtg
cgcaaccagaagagagaggggcttatccgtgcacgcatcgagggctggaaggtggcttct
ggggaggtgacaggcttctttgatgcccatgtggaatttacaccaacctgggctgaacca
gtcctctccaggatcaaggagaatcgcaagaggatcatcctgccctctattgacaacatc
aagcatgagacgctggagcttgagcgatacgagaactctgggcacggatacaactgggaa
ctctggtgcatgtacatcaacccccccaagcagtggtgggatgagggggacacctctgct
cccatcaggactccagcaatgattggctgttcctttgtggtgaaccgggattattttgga
gagctgggcttgctcgaccctggaatggatgtctatggaggggagaacattgagcttgga
atcagggtgtggctgtgcggtggcagcatggaggtcctgccctgctccagggtggcgcac
attgcacggatgaagaagccatatcacagcaacatcgccttccacgcacgccggaatgca
ctgcgtgtggccgaggtctggatggacaattacaagtctcatgtctatctggcctggaac
ctccccatggaaaaccatggaatagactatggtgacatctcccaaagagtagccctgagg
aaaagtctgcagtgtaagaactttgagtggtacctaaacaacgtctatccagagatgcga
agatacaacaacacagtctattacggggaaatccgtaacacaaaagtgagccacctgtgt
atggaccagggagtcaaagagaaccatacagccactctgcacccctgccatgggtggggc
cctcagctgggccgctacaccatggagggccagttgcacctgggcccactgggcagcacc
ggcgaggacacgcgctgcgtagtggacgaccgcctcagcaacctgccccagatgctcaac
tgcgacaaggtgtctagtgtgccccacaagacctggaacttctcccagaatgagtccatt
gtcaatagaggtacgggccgctgtctggaggtgatcccagccaacatcaattttggtcac
ctgcttgtcctgcagccctgtactgggcagcggtggtacatcaaaaataccatgaggcta
ccgtga

DBGET integrated database retrieval system