KEGG   Scleropages formosus (Asian bonytongue): 108922553Help
Entry
108922553         CDS       T04919                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETD1B-like
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108922553
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sfm03036]
    108922553
Enzymes [BR:sfm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108922553
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108922553
   HMT complexes
    COMPASS/SET1 complex
     108922553
    COMPASS/SET1 complex (yeast)
     108922553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 108922553
NCBI-ProteinID: XP_018588269
UniProt: A0A1W4Y9C0
LinkDB All DBs
Position
Unknown
AA seq 2323 aa AA seqDB search
MDPDSGLEAQRALSVPWKSYKLIQDPAIRRVSQKVYRYDGVHFNVPDSGFTPVGELRDPR
PRRIWSKRTELTLPVPRFKLDEFYVGPIPLKEVTFARLNDNIREPFLAEMCAKFGEVEEM
EILFHPKTRKHLGLARVIFTSTRGAKDTVKNLHNTSVMGTIVHAQLDIRGQQRMKYYDLI
VSGTYTPQTVPTGGKALSEKFQAPAPASTHPDTSSDIRRRPSVDLMGSGVPPLTPGSTTP
CSADTGFSEQRLDTPISSLGGPYTPGSSASSQGGGTPYTPRSGTPFSQDSGFGGRYGNLG
YGGGNGSGMSSSYPPQDLLPSSSCSSSAVSSSSSGGSYMPSRFHEDLHPPPQEGPLFHRG
RLPYPPPVSYRPNEPPPYPPYPSSAAAGQLQLHSPLPPPPPASQYETPALSERDRERERE
RDRDSGARYGGGISARRSSYHHHPQEANASSKLSSYHSHHHHHHHSERRDDRGYRSGSSG
GSSGSRSGDHSHQRHRNHHHSHSRRRGSRDRDRERVRDRERDRDRDKDKESEYPNNSDLP
LSGYSFPSKEAPPLPPHDMEPTSSFRPQQMGGAPRERGLGTDKDYRLQTPIPPPPPPPPP
PLPPASVIAAAVAETYSAADYDQESPPPEDKWAKVKRRPRTPPLPPQTSLSSKHFPSSPV
HPSITSSSSSPSSSSLPLHSSRSPPLSCLERNSSSPEPDSTNESLPFVYHSSSLDSRIEM
LLKEQKAKFSFLASDEEEEEEKDEKSRVEESDSGVPLGDGEGLGCKGEPRERESERDRQR
RREGDWEVGDTEEGKTKWKGEHERECEGLRRKSRKEGGGDVRRSPTAGAAVTPSLTSSAR
TPPLEAEQAHLGRAATDQEEVHASSPADPRKRLGAHTPPTYNGQGQNSPRSSGEDMEISD
EDECATSAGTTHHSGLPSSSSSPVPSSQSAPPSQTPDPASSPPARSDSAQHFGXXXHGFS
LQPPPPPGIPPPLPHMELHPEYPPPIPHHMYDYTSSVELMNQYSGGAPMSFQMQTQMLSR
LYQMRMASSNGTATPGDPSQSDYPPSFPHDMSHLHSLPPPHPHHPYLDQEGGSAHFDQDH
RYMPPPIPYPYPDPHGPQLPPPHHHGLPPPHSSWPHHIAPPHYPSYLHPPPYGPLSPSTS
STTSSYGAQYGGVGGSHLPVLAQHPHEATVRLVLAALIQEMRSIVQRDLTRKMVENIAFG
TFDEWWERKERKAKPFQTVVRSASVARAEEDRKEKEEKPNSRPREPMLSLVDWAKSGGME
GFSLRGALRLPSFKVKRKEPMELKDTGEMKRTRPSTPPDEEDEDSYQEKGPDTMDGRGEG
RDARSERDVQRARKRIKRKKPFDLDSEGEETSDASSSDKEDDDDDEDSDKEDESEDEALS
GDSDDESISSSSSESSSSSSSSSTTSSSDEEEDDEEEVAQAGESEGIDTMDESTMDSAVL
DVERDDESEQDHVKQLGTTTLEDSKVSDVKAGIAETQKTGTEDKQAAQTFLGSDRPPSPP
PPPRPSSPIMLLPPLKKRRKTVSFSTEESDGKAAQPSSLLAAPASPVPCPAPTQSLLLSP
VKAQPPDSILTASSPSSTPATPPSAVSAKPSPMLLPFASKPGEGSTLSTAPSPGSVLTVP
PPIRSLRPDEPKKSTGPPTSPQMPLAKSPPASKRGVPKETLPKAPALPAPLVCQTVQNLP
PDHASMVRMAYEEPTSLPPVSSPPPAQRGRPRGRSRTSSVSAATAPLHPCPREDDKDQVD
RGLKQRLKEQLVATPTTSAPPPDLSVLADVALKLEPETQDSEETETSDEAEEQKQSLGVE
STSTETGTQSQALHLEGQFVWLEHNYSKPVMHTVTPPSPAQKKTKADIHPVILSPDISHH
AISVVLEAPEEVIGEVQPATEDAVELHSPLGVGLLGECGDAKAAIIAVLPTAKQRGPAAR
EVDLVEEVAKGKSKGRKKRRRKEKEEQQKTKKQKVRLSKKERKRKLEEMELEEVDVEQLE
AEALEESDESAEEDEEEEWRESEDVRKSERLLIQEAKARSKPKPQTPPKTFELRSEFEQM
TILYDIWNSGLDMEDMQLLKMTYERLLQEEHSMDWLNDTHWVPHTITNIPNPRRKRKNLD
EQLREHVTGCARSEGYYAISRKEKDIYLDLYPGSAQELDHDNLASNRVLSERRSEQRRLL
SAIGTQAVMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQ
MVADNREKRYAQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQK
KIVIYSKQPIGINEEITYDYKFPIEENKIPCLCGTENCRGTLN
NT seq 6972 nt NT seq  +upstreamnt  +downstreamnt
atggatcccgacagcgggctggaagctcagcgagctctcagcgtgccgtggaagagctac
aaactgatccaggacccggccatccgtagggtctctcagaaggtgtaccgatacgatggg
gtgcacttcaacgtaccggattcgggtttcaccccagtgggggagttgagggacccgcga
ccccgcaggatctggtccaaacgcacagagctgactcttccagtgcccagattcaagttg
gatgagttttacgtgggccccattcctctgaaggaggtgacctttgcgcgcctgaatgac
aacatccgggagccttttttggctgagatgtgtgccaagtttggtgaggtggaggaaatg
gagatcttgttccaccccaagacacgcaagcatcttggccttgcccgcgtcatctttacc
agcaccaggggtgcaaaggacactgtcaagaacctgcacaacacctcagtcatgggcact
atcgtccatgcacagctggacatccgaggccagcagaggatgaagtattatgacctgata
gtcagtggtacttacaccccgcagactgttcccacaggagggaaggccctgtctgaaaaa
tttcaagcccctgcacctgcctccacacacccagacacatcttcagacattcggcgcaga
ccttctgtcgaccttatggggtctggtgtgccccctctcaccccgggcagcaccactccg
tgctctgcagacacaggcttcagtgagcagcgcctagacacgcccatttcctcgctgggg
gggccctacacccctggttcctctgcatcctcccagggcgggggcacgccttacacacct
cgctcagggacacccttctcccaggactcgggcttcggggggagatatggaaatttgggt
tatggtggaggcaatggcagtggtatgagcagcagttaccctccacaagacctgctgccc
tcttcctcctgctcttcctccgcagtgtcttcgtcgtcttctggaggaagctacatgccc
tcacgtttccacgaagaccttcatccaccaccccaggaggggccactgttccacagggga
cgccttccttaccccccaccagtttcctatcgcccaaatgagcctcctccctaccctcct
taccccagcagtgcagcagcaggacaactgcaactccactcacctctaccacctccaccc
cctgcctcccagtacgagaccccggccctctcagaaagggacagggagagagagagagaa
cgagacagagactctggggcacggtatgggggtggaatcagtgcccggcggtcctcttat
caccaccatccacaggaggccaatgcgtcttctaagttatcttcgtatcactctcaccac
caccaccaccatcactctgagcggagagacgaccggggctaccggagtggcagcagcggt
ggcagctcgggctctaggtctggggaccatagtcaccagcggcaccggaaccaccaccac
tcccatagccgacgccggggcagccgggaccgagaccgggagcgggtcagagatcgcgag
agggatcgggacagggataaagacaaggagagcgagtaccccaacaactcagaccttcct
ctgtctggctactcgttcccttcgaaagaggcacccccactgcctcctcatgacatggag
cccacatcaagcttccgtcctcaacagatgggaggagcacccagggagagaggtctgggc
actgataaggactaccgcctccaaacccccattccaccgcctcctcccccaccaccgcct
cccttaccaccagcttcggtcattgcagctgcagttgctgagacttacagtgcagcagac
tatgaccaggagagtccaccccctgaggataaatgggctaaggttaagcgcaggcccagg
acccctccacttcctccccagacatccctctcgtcaaagcactttccctcctcaccagtc
catccctcgatcacctcttcctcttcctccccttcctcctcctccctccctcttcactcc
tctcgctcccccccactctcttgcttggagcgcaactcctcgtcccctgaaccagattcc
accaatgagagcttgccgttcgtctaccacagcagcagcctagactcacgcattgagatg
cttttgaaggaacagaaggccaaattctccttccttgcatccgatgaggaggaagaggaa
gagaaggatgagaagtcacgggtggaggagagtgatagtggagtgccgctgggtgatgga
gaaggtctgggctgcaaaggtgagcctagagagagagaaagtgagcgagacagacagagg
aggagggaaggagactgggaggtgggagacacggaggaaggcaaaactaagtggaaaggg
gagcatgagagggagtgtgaaggcctcaggaggaagtccaggaaagaagggggaggagat
gtgaggagaagcccaacagcaggggcagctgtgactccatccttaacctcttcagcccga
acacctcctctagaggcagagcaagcccacctgggccgagctgccacagaccaggaggag
gttcacgcttccagtccagccgacccccgcaagaggctcggcgcacacacccctccgact
tacaatggacagggtcagaactccccccgttcgtccggcgaggacatggagatatcagat
gaagatgaatgtgccacctccgctggcaccacgcaccacagtggcctgccttcctcctcc
tcctctccagtcccgtcgtctcagtctgccccaccatcccagacccctgatcctgcttcc
tcaccccctgcccggtctgactctgcacagcactttggnnnnnnnnctcatgggttctcc
ttacagcctccccctcctcctggtatcccgccacctctccctcacatggagctgcaccca
gagtatccccctcccatccctcaccacatgtacgactacaccagctctgtggagctcatg
aaccagtacagcggcggggcccccatgtcctttcagatgcagacgcagatgctgagccgg
ctgtatcagatgcgcatggcctccagcaatgggacagctacccctggtgacccttctcag
tcggactaccctccctccttccctcatgacatgtcccacctgcactctctccctcctccg
cacccgcaccacccgtacctggaccaagaagggggcagtgctcactttgaccaggatcac
cgctacatgcctccgcctatcccatacccttaccctgacccccatggtccccagctccca
cctccccaccatcacgggcttcctcctccccactcttcatggccacaccatatagcccct
ccgcattacccgtcctatctccacccacctccctatgggccgctgtccccctctaccagc
tcgaccacatcctcatatggggcccagtacggtggggtggggggctcacatttgcccgtg
ttggcccagcatccccatgaagccacagtgcgcctggtgttggctgccctcattcaggag
atgaggagcatcgttcagagggacctgacacgcaagatggtggagaacatcgcctttggc
actttcgacgagtggtgggagcgcaaggagaggaaggccaagccttttcagacagtggtg
cgcagtgcatcagttgctcgagcagaggaggataggaaggagaaggaggagaagcccaac
agccgccctcgggaacccatgctctccctagtggactgggccaagagtggtggcatggag
ggcttttctctccgcggggcactccggttgccctctttcaaggtgaagaggaaggagccc
atggagctcaaggacacaggggagatgaagaggacccgtccttcaactccaccagacgag
gaggatgaggactcgtaccaggaaaagggtccagacactatggatggacgtggggaaggc
agggatgccagatcagagagagatgtacagagggcaagaaagcggataaagaggaagaag
cccttcgacttagacagcgagggagaggagacctctgacgcctcttcctcagacaaggag
gatgatgatgatgatgaagacagcgataaggaggacgaatctgaagacgaggctctgagt
ggtgacagtgatgatgagagcatttcctcctcgtcctcggaaagcagttcctcatcttca
tcatcttcaaccacctcttcctctgatgaggaggaggatgacgaagaagaggttgcacaa
gctggcgagagtgagggcatcgacaccatggacgagtctacgatggacagtgccgtgctg
gatgtggaaagagatgatgagagtgaacaggatcatgtcaagcaactcggcaccacaacc
ttggaagacagcaaagtttctgatgtcaaagcaggaatagcagaaacacagaagactgga
acagaagacaagcaggcagcccagaccttccttggctcagatcgcccaccttcaccacca
ccaccccctcgcccttcttctcctatcatgctcctccctcctctcaagaagcgacgcaag
acagtctccttctctacagaggaatcagatggcaaagcagcacagccttcctctcttctt
gcagcccctgcctcacctgttccttgccctgcccccacgcagtccctcctcctttctcct
gtgaaggcccagccaccagattccatacttacagcctcttccccaagttccacaccagcc
actcctccttcagcggtcagtgccaaaccctcccctatgctcctcccgtttgcctccaaa
ccaggagaaggcagcaccctctccacagcaccctcgccaggctctgtcctcactgtacct
ccacctatccgctcacttcgtcccgacgagcctaaaaagagcaccggcccacccacatct
ccacagatgcccctggcaaagtctccaccagcctccaaacgaggggttcccaaggagact
ctgccaaaggctccagctctcccagcccctctagtttgccagactgtccagaacttgccc
ccagaccatgcatccatggtgaggatggcctacgaggagcctacctcccttccccccgtt
tcctctcctccaccggctcagaggggacgtcccaggggccgttctcggacctccagcgtt
tcagctgcaaccgctcctttacacccatgtccacgggaggatgacaaggatcaggtggac
aggggattgaaacaaaggctcaaggagcagctagtcgcaacccccacaacatcagcgcct
ccgcctgacctctccgtccttgctgatgtggccctcaagctggagcctgagacgcaggac
tcggaggaaacggaaacgtcggacgaggccgaggagcagaaacagtcactgggtgtagag
agcacaagtactgagactggaacgcagtcgcaagcccttcatctggagggtcagtttgtg
tggttagagcacaactactcaaagcctgtgatgcacactgttacaccaccttcccctgcc
cagaagaagacaaaagcagacatccacccggtcattctgtccccagacatcagccatcat
gccatctcggttgtgcttgaggcccctgaagaggtgattggggaggtgcagccagccaca
gaggatgctgtggaacttcactcacctttaggggtgggcttattgggggagtgtggggat
gctaaggctgccattattgctgtcctgcccactgcaaaacaacgagggccagcagccaga
gaagtcgacctggtggaagaggtggcgaaagggaagagcaaaggcaggaaaaagaggaga
aggaaggagaaagaggagcagcagaagaccaagaagcagaaggtgcgcctaagcaaaaag
gagcgaaagaggaaactggaggaaatggagctcgaggaggtggacgtggagcagctggag
gcagaggccctggaagaatcggatgagtctgcggaggaggatgaagaggaagaatggcgt
gagtcagaagatgtccggaagagtgagcgactgctcatacaggaggccaaggcgcgaagc
aagcctaagccccagactccacccaagacctttgagctgaggagcgaatttgagcagatg
accatcctttatgatatctggaactcgggcctggacatggaggatatgcagcttctcaag
atgacctatgagaggctcctacaagaggagcacagcatggactggctcaatgacacccac
tgggtgccccatactatcaccaatatcccaaatccacggcgcaagaggaagaacctagat
gaacaactacgggaacatgtaactggctgtgctcgcagtgagggttattatgccatcagt
cgcaaggagaaggacatctacctcgacctctatcccggatctgcccaggagttggaccac
gacaatctggccagtaaccgagttttgtctgagcggcgatccgagcagcgtcgcctgctc
agtgccattggaacacaggctgtcatggattctgacctgctgaagctcaaccagctcaag
ttccgaaagaagaagcttcgttttgggcgcagccgaatccacgagtgggggctgtttgcc
atggagcccattgccgcggacgaaatggtcatagagtacgtaggccagaacatcagacag
atggtggctgacaaccgggagaagcgctacgcgcaggagggcatcgggagcagctatctg
ttccgcgttgaccatgacaccatcatcgacgcaaccaagtgtggcaacctggcccgcttc
attaaccactgttgcaccccaaactgctatgccaaggttatcaccatagaatcccagaag
aagattgtgatttattcgaagcagcccatcgggatcaatgaggagatcacctatgactac
aagttccccatcgaggagaataaaatcccttgcttgtgcggcaccgagaattgccgtggc
actctcaactag

DBGET integrated database retrieval system