KEGG   Scleropages formosus (Asian bonytongue): 108922701
Entry
108922701         CDS       T04919                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04012  ErbB signaling pathway
sfm04068  FoxO signaling pathway
sfm04110  Cell cycle
sfm04115  p53 signaling pathway
sfm04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108922701
   04068 FoxO signaling pathway
    108922701
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108922701
   04115 p53 signaling pathway
    108922701
   04218 Cellular senescence
    108922701
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 108922701
NCBI-ProteinID: XP_018588515
LinkDB
Position
2
AA seq 228 aa
MSCCAVGFAQACRSLARRRDRAAARVLPTEGNLNSRAHVPSRDLRPRLSRRRGLEVSVTS
RRTIMCRIMPIEKRVLAALRSGSTRRILFGPVDHEGLRRDHQKLLRDDLEDASRRWGFDF
LTDTPIEGSDFQWESVPVAKVPVLYRPSTVSVGEPQRLGAAPKPAVESVQRSRETVSCIS
ESCNILSQNVESVPEVKQGHAVKRKQTNITDFYQAKRRAVSTPRKSGQ
NT seq 687 nt   +upstreamnt  +downstreamnt
atgtcgtgctgcgctgtaggatttgcccaggcatgtaggagcctcgcgcggagacgtgac
cgcgcagcggcgcgagtcctgcccactgaggggaatttaaatagccgcgcgcacgttccg
tctcgagatctcagacctcggctctcccggcgacgcgggctcgaagtgagcgtcacgtca
cgtcgcacaatcatgtgtaggatcatgccgattgagaagcgagtcctggcggcactgagg
agcggctcgacccggcggattctcttcggtcccgtggaccacgagggcctgcggagagat
caccagaagcttttgcgggatgacctggaggatgcctcgcgccggtggggttttgacttc
ctgacagatacacccatcgagggcagtgatttccagtgggagagcgtccctgtagccaaa
gtgccagtgctgtaccgtccttccacggtcagtgtgggtgagccgcagaggctgggggca
gcaccgaagccggcggtggaaagtgtccagaggagccgggagactgtctcatgtatttct
gagagctgcaacatcctgtcccagaatgtggagagcgtaccagaggtgaaacagggtcac
gcagtgaagaggaagcagaccaacattacagatttctatcaggctaagaggagagcagtg
agcacgcccaggaaatcgggccagtga

DBGET integrated database retrieval system