KEGG   Scleropages formosus (Asian bonytongue): 108922803
Entry
108922803         CDS       T04919                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X2
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
sfm04020  Calcium signaling pathway
sfm04144  Endocytosis
sfm04510  Focal adhesion
sfm04540  Gap junction
sfm04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108922803 (pdgfra)
   04020 Calcium signaling pathway
    108922803 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108922803 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108922803 (pdgfra)
   04540 Gap junction
    108922803 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108922803 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108922803 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:sfm04090]
    108922803 (pdgfra)
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108922803 (pdgfra)
Protein kinases [BR:sfm01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   108922803 (pdgfra)
CD molecules [BR:sfm04090]
 Proteins
  108922803 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C2-set_2 C1-set Kinase-like Adeno_E3_CR1
Other DBs
NCBI-GeneID: 108922803
NCBI-ProteinID: XP_018588678
LinkDB
Position
9
AA seq 1486 aa
MKVMSWAMELWGRMLTVSVMCLAIFTGPQVALGQLPPPSIVPRQSVFIVEPRGSLTVTCT
GVRQVQWVTPLPHNFALVSGLHTAVLQVSNASAENTGLFVCMYDPPEVEDEQSEAHIYIY
VPDPQVLFVPEPLENTQIFHNPEGTDIIPCRVTHPLSQVVLRRLPEGPQVEALYLSDTGF
VGNFLSGSYVCETSMNGETHSSAVYTLEDAKGEGDDFHMEVRASQEAVLAGEPFNITCEV
PAGAQYQQQWLHPKKQAAEALQNKHIVGDTVYYTLSISSASHEDSGEYECAVTNSLTGMT
EAQTVAVQVLGGDSFIKLQHNIRAEEFATRLEERVFNVDIYAHPPPTVRWLKDDQEVGRA
HNSVFSKTTPLGNHRYKSTLTLSRPLEDSNGNYTIVISRGVFPVDSQEMRFSFSLTVRGP
SETFHPLTPPEIWPQHEDMVVPLHESFTVSCRGEQEMVWKTPLPDHLMGTLEDNSGLFVS
TLTVENATGAHTGYYVCSYLGSNGTAESLLTSAIYVYVPDPQVPFIPSTGLFGTHILTDP
DGMEIQCRVSDPSANVTLHSVDSQEPVTATFDSKRGMVGVFSAGTYICKAVINGEEYLSE
EYIVHGWTGGDSDLKVDLQVDRTAVRAGESLLVTCVARGKEILEDHWKYPGKMANRGEKA
VKENKKKKEIQYTLTIPQAQAKDSGLYECSISDIDSDVSITREVTITVYERDFIVLEPSF
AAIQFAELDEVKEFTVSFDAFPTAKVTWLKDGRVLTDSHETTSRFHHINETRYQSSLLLI
RAKEEDSGNYTIQVENGNQSLSYSFTLRVNVPPVIVDLMDLHHGSATGQSVVCIAGGQPT
PEVEWFVCKNIKLCANDSAQWTSLAVNSTEISVETHVNQDNQLESQVIFAKLENTLSVRC
LARNQLAAVSREVKLVSNALQSELTVAAAVLVLLVIVVISLIVLVIIWKQKPRYEIRWRV
IESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLGSGAFGKVVEGMAYGLSVSQPV
MKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGD
LVNYLHKNRENFMSGHPEKAKKELDIFGINPTDESSRSYVILSFESKGDYMDMKQADATQ
YVPMLEMRDASKYSDVQRSNYDHPPSHKHTSPSESEVNRLLSDDTSEGLSTMDLLSFTYQ
VARGMEFLASKNCVHRDLAARNVLLSQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKW
MAPESIFDNLYTTLSDVWSYGVLLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMAKPEHA
SEDVYEMMMKCWNTEPEKRPSFFSLSETVASLLPAEYKKCYEQVNREFLRSDHPAVTRVR
AVADDAYVGISYKNQGKLKDRESGFDEQRLSSDSGYIIPLPDLDPLSDDEHGKRNRHSSQ
TSEESAIETGSSSSTFVKRGEGETLEDVEALDMCSESGDMVEDSFL
NT seq 4461 nt   +upstreamnt  +downstreamnt
atgaaggtgatgtcctgggccatggagctgtggggcagaatgctgacagtcagcgtcatg
tgtctggccatctttacagggccccaggtggcactcggccagctcccccctccctccatc
gtacccagacagtcggtgttcatcgtggaaccacggggctcgctcaccgtcacgtgcaca
ggtgtgcgacaggtgcagtgggtgacccccctgccgcacaactttgcgctcgtttctggt
ttacacacagccgtgctgcaggtgtccaacgcgtcggccgagaacacggggctcttcgtg
tgtatgtatgacccccctgaagtcgaggatgagcagagtgaagcccacatttacatatat
gtaccagacccccaggtcttgttcgtacccgaacctctcgagaacacgcagatcttccac
aaccccgagggcacagacatcatcccgtgccgtgtgacccacccgttgtcgcaagtggtg
ctcaggaggctgccggagggcccacaggtggaagccttgtacctgagtgacacaggcttc
gtgggcaacttcctcagcggctcctacgtgtgcgagacgtctatgaatggagagacgcac
agcagcgccgtctacacgctggaggacgccaaaggagagggcgacgatttccacatggag
gtgcgtgccagtcaggaggcagtgctggctggggaacccttcaacatcacctgcgaggtc
ccggccggtgctcagtaccagcagcagtggctgcaccccaagaagcaggctgctgaggcc
ctacagaacaagcacattgttggagacactgtgtactacaccctcagcatcagctcagca
tcccacgaggacagcggagagtacgaatgtgccgtcaccaactccctgacaggcatgacc
gaagcccagacagtggcggtccaggtgttagggggggactcgttcatcaaactgcagcat
aacatcagagcagaggagtttgccacccggctcgaggagagagtgttcaatgtggacata
tacgctcacccccccccaaccgtgcggtggctcaaagatgaccaggaagtgggcagggct
cataacagcgtgttcagtaaaaccacacccctcggcaaccataggtacaagagcacgctt
acgctgtcccgccccctagaggacagcaacgggaactacaccatagtgatctccagagga
gtgtttccagtggacagccaggagatgcgcttctccttctccctgacagtgagaggcccc
agtgagacgttccatcccttgacgccgccggagatctggccgcagcacgaggacatggtc
gtcccgctccacgagagcttcacggtgagctgcaggggtgagcaggagatggtgtggaaa
acgccactgccggaccacctgatggggacgctggaggacaacagtggtctctttgtgagc
accttgaccgtggagaacgccaccggtgcccacacgggctactacgtctgctcctacctg
gggtccaacggcacggccgagtccctgctgacgagcgccatatacgtctacgttccagac
ccccaggtgccattcatcccatccacgggcctgttcggcacccacattttgacagaccct
gacgggatggagatccagtgccgcgtgtcggaccccagcgccaacgtgacgctgcacagc
gtggactcgcaggagccggtgacagccaccttcgacagcaagcggggcatggtgggcgtc
ttcagcgccggcacctacatctgcaaggccgtgatcaacggcgaggagtacctcagtgaa
gagtatatcgtccacgggtggacaggtggtgactcggacctcaaggtggaccttcaggtg
gaccggacagctgtaagggctggagagagcttgttggtgacctgcgtggcaagaggcaag
gagatcctagaagaccactggaagtaccctgggaagatggcaaaccgaggagagaaggca
gtgaaggagaacaagaagaaaaaggagatccagtacacactaaccatcccccaggcacag
gctaaggacagcggcctgtacgagtgctccatctcagacatcgacagcgacgtgagcatc
accagggaggtgaccatcactgtctacgagagggatttcattgtcctggagcccagcttt
gctgcgattcagtttgctgagctggacgaggtgaaggagttcacagtcagcttcgatgcc
ttccccacggccaaagtcacttggcttaaagatggaagggtcctcactgacagccatgaa
acaaccagcaggttccatcacatcaacgaaaccaggtaccagagcagtctgcttctgata
cgagcaaaagaagaggacagtgggaactacaccatccaggtggagaacggaaatcagagt
ctgagctatagcttcacacttcgagtgaatgtgcctccagtgattgtggacttgatggac
ctccaccatggctcggccacaggccagtctgtggtgtgcattgctggcggtcagcccact
cctgaagtggaatggttcgtctgcaaaaacatcaaattgtgcgccaacgattccgctcag
tggacttctctggccgttaactccactgagatctccgtggagacgcacgtcaaccaggac
aatcagctggagagccaggtcatcttcgccaagctggagaacacgctgtctgtgaggtgt
ctggccagaaaccagctggcagcggtcagccgggaggtgaagcttgtctcaaacgctctg
cagtcggagctgactgtagcggcggccgttctggttcttctggtcattgtcgtcatctct
ctcattgtcctcgtcatcatctggaaacagaaacctcgctatgagatcagatggcgtgtg
attgaatccatcagtccagatggacatgagtacatctatgtggaccccatgcagcttccc
tacgactccagatgggagtttccccgagatggacttgttctgggccgcgtcctgggctcc
ggtgcattcgggaaggtagtggaagggatggcttatggtctcagtgtctcgcagcccgtc
atgaaggtggccgtcaagatgctcaaacccacagcaaggtcgagtgagaagcaggccctt
atgtctgagctgaagattatgacacatctcggccctcacctgaacatcgtcaacctgctg
ggggcctgcaccaagtcagggcccatatacatcatcacagagtactgcttctacggtgac
cttgtcaactacctccacaagaacagggagaactttatgagcgggcacccagaaaaggca
aagaaggagctggacattttcggcatcaaccctacagacgagagcagcaggagctatgtc
atcctgtccttcgaaagcaaaggagactacatggacatgaagcaggctgacgcgactcag
tatgtgccgatgctggagatgcgtgatgcctccaagtactcggacgtgcagagatccaac
tacgaccacccgccttctcataagcacacgtctccgagcgagagtgaggtgaacagactg
ctgtcagatgataccagtgaaggattgagcaccatggacctgctcagtttcacataccag
gtggcacgaggcatggagttcctggcctccaagaattgtgtgcatcgggacttagctgca
agaaacgtcctcctgtcccaaggcaagattgtgaagatctgcgactttggcctcgccagg
gacatcatgcacgacagcaactacgtctccaagggcagtaccttcctgccggtgaagtgg
atggcacccgagagtattttcgacaacctgtacaccacgctgagtgacgtgtggtcctac
ggcgtcttgctgtgggagatcttctctctgggtggaactccatatcccggcatggttgtg
gactccagcttctacaacaagatcaaaagtggctacaggatggcgaagccggagcacgcc
agcgaagacgtatatgagatgatgatgaagtgctggaacacggagcctgagaaaagaccg
tccttcttcagcctgagtgagacggtggcctctctgctgcctgcagagtacaagaagtgt
tacgaacaggtgaaccgtgagttcctgcgcagcgaccaccccgctgtgactcgtgtgcgc
gcggtcgccgacgacgcctacgtgggcatcagctacaagaaccaggggaagctgaaggac
agggagagcggtttcgatgagcagcgcctcagttccgacagcggctacatcatcccgctg
cccgacctggacccgctgtccgacgacgagcacggcaagaggaaccggcacagctcccag
acgtcggaggagagcgctattgagacgggctccagcagctccaccttcgtcaagaggggt
gagggcgagaccctggaggacgtggaggcgctggacatgtgctccgagtcgggggacatg
gtggaggacagcttcctgtag

DBGET integrated database retrieval system