KEGG   Scleropages formosus (Asian bonytongue): 108923213Help
Entry
108923213         CDS       T04919                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 4 regulatory subunit 3
  KO
K17491  protein phosphatase 4 regulatory subunit 3
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sfm01009]
    108923213
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108923213
Protein phosphatases and associated proteins [BR:sfm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-4
    Regulatory subunits
     108923213
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Protein phosphatase 4
     108923213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SMK-1 WH1 Ran_BP1
Motif
Other DBs
NCBI-GeneID: 108923213
NCBI-ProteinID: XP_018589379
UniProt: A0A1W4YCP5
LinkDB All DBs
Position
15
AA seq 825 aa AA seqDB search
MTDTRRRVKVYTLNEERQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNT
AYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQELVDESEEE
RFDDMSSPGLELPPCELSRLEEVAELVASSLPSPLRREKLALAVENEGYIKKLLELFHVC
EDLENHEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEFDPSLPQPRRHREFL
TKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEI
VGMLQDDEKFLTDLFAQLTDEATDDDKRHELVNFLKEFCAFSQTLQPQNRDAFFKTLSNM
GILPALEVILGMDDPQVRSAATDIFSYLVEYNPSMVREFVMQESQQNDDDILLINLIIEH
MICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKSEFLSFFYKHCMHVLSAPLLANT
TDEKPSKDDFQTSQLLALILELLTFCVEHHTYHIKNYIINKDILRRVLVLMASRHAFLAL
CALRFMRKIIGLKDEFYNRYIMRNFLFEPVVKAFLNNGSRYNLMNSAIIEMFEYIRVEDM
KSLTAHVVENYWKALEDVDYVQTFKGLKLRYEQQRERQDHPKLDSMRSILRNHRYRRDAR
TLEDEEEMWFNTDEDDLEDGEAIVPPSDKMKSDEDLMDPISKFMERRKLKDAEEKEVLGK
SSLSGRQSPSFKLSFSSTTKASLTSPSSASHLPGSPGSPGSTGSPGSPGSGAKSSPPAPA
ITTKGGLVGLVDYPDDDDDEEDDDEDDSENRDESPPLSKKSKLSS
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgacggacactcgacgacgagtgaaggtttacaccctgaacgaggagcggcagtgggac
gaccgcggcaccggacatgtgtcctccgggtacgtggagcgcctcaaaggcatgtccctg
ctggtccgggccgagagcgacggttctcttctgctggaatcaaaaataaatcccaacact
gcataccagaaacagcaggacacattaattgtatggtctgaagcagaaaactatgacttg
gcactcagttttcaagagaaggcaggatgtgatgaaatatgggagaaaatatgccaggtc
cagggtaaagatccatcagtggacatcacccaggagcttgtggatgagtctgaagaggag
cgcttcgatgacatgtcatcccctgggttggaactgcctccctgtgagctgagccggttg
gaggaggttgcggagctggtggcatcatcactgccatcaccactgcgccgcgagaagctt
gcccttgctgtggagaatgagggctacatcaagaagctcctggagctcttccatgtctgt
gaagatctggagaaccatgaggggctacatcatctgtatgagatcataaagggaatcttt
ctcttgaacagaacagcactcttcgaggttatgttctcagaggaatgtatcatggacgtg
attggttgtctggagtttgatccctccttgccccagcccaggagacacagggagttcttg
acaaagactgcaaagttcaaggaggtcattcccatatcagaccctgaactgaagcagaaa
atccaccagacgtatcgagtacagtacattcaggacatggtcctccccaccccttcggtg
tttgaggagaatatgctgtccactctccactcttttatcttttttaacaaagtggaaatt
gttggaatgttgcaggacgatgaaaagttcctgacagatctctttgcacaactaactgat
gaagcaacagatgacgacaaaagacatgagctggtaaatttcctgaaggaattttgcgca
ttttctcaaacattacaacctcaaaacagagatgccttcttcaaaacattgtcaaatatg
ggcatcttaccagcacttgaagttatattgggaatggacgacccccaagtgcgcagtgca
gcaactgacatcttctcctatttggtggagtacaatccttccatggtacgggagtttgtt
atgcaggagtctcagcagaatgatgatgacatcttgctgatcaacctgatcatcgagcac
atgatctgtgacacggatccagagttgggtggtgctgtgcagctgatgggcttgctacgc
accctggtggatccggagaacatgctggccacagccaataaaacagagaaatctgagttc
ttgagtttcttctacaagcactgcatgcatgttctttctgcaccattgctggccaacaca
acagatgagaaacccagcaaagatgacttccagacgtcacaactgttggcactgattctg
gagctgctgaccttttgcgttgaacaccacacctaccatatcaagaactacatcatcaac
aaggacatcctgcgtagggtgctggtgctcatggcctcccgacatgccttccttgcactc
tgtgctcttcgtttcatgcggaaaataattgggttgaaagatgagttttacaatcgctac
atcatgaggaacttcttgtttgaaccagtggtaaaagccttccttaacaatggatctcgt
tacaacctcatgaactctgcaataatcgaaatgtttgagtatatcagagtggaggatatg
aagtctctgacagctcatgttgtagagaactactggaaagcacttgaagatgtagattat
gtgcagacattcaaaggcctgaagctacgctacgaacaacagagggagaggcaagaccac
ccaaaactggacagcatgcggtcaatcctgaggaatcatcggtatcggcgggatgcacgc
acacttgaagatgaggaggaaatgtggttcaacactgatgaggatgacctagaagatgga
gaggctattgttccaccctcagacaaaatgaagagtgatgaagacctaatggaccccatt
agcaagttcatggaaaggaggaaattaaaagatgcagaggagaaggaggtgctagggaag
tcaagcttatcagggcgccagagccctagcttcaagctgtctttctctagcaccaccaaa
gcaagtctcaccagcccatcctctgccagccaccttcctgggtcaccaggctccccgggc
tcaactggctcccctgggtcgccaggctctggagctaaaagctcacctcctgctcctgcc
atcaccaccaagggtggactagtaggattggtggactaccctgatgatgatgatgatgag
gaggatgatgatgaagatgattcagagaacagggatgagagtccaccactttccaagaag
tctaagctgagctcttag

DBGET integrated database retrieval system