KEGG   Scleropages formosus (Asian bonytongue): 108923308Help
Entry
108923308         CDS       T04919                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00250  Alanine, aspartate and glutamate metabolism
sfm00410  beta-Alanine metabolism
sfm00430  Taurine and hypotaurine metabolism
sfm00650  Butanoate metabolism
sfm01100  Metabolic pathways
Module
sfm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    108923308
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108923308
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108923308
   00430 Taurine and hypotaurine metabolism
    108923308
Enzymes [BR:sfm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     108923308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC RVT_1 DUF1891 Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 108923308
NCBI-ProteinID: XP_018589489
UniProt: A0A1W4YD04
LinkDB All DBs
Position
Unknown
AA seq 812 aa AA seqDB search
MLPAVLAEIRMTPSSTIKLSPVEVLMDKPMHNFVPNQLVLIRSLKPVKVGEPKYLGPATV
IALSVKLRVLSLNNSLCNWILGFLTGRRQVVRIGCNISSPLSLNNGAPQGCVLSPLLYSL
YTHDCVATHSTNAIVKFADDTTVVGLITDSNEGAYREEVHTLTHWYQENHLLLNTTKTKE
IIVDFRRQERDPTPITISGTPVERVTSFKFLGVHITEDLTWTSHTNAVVKKAHQRLFFLR
RLRKLRMNQNILKTFYTCAVRASLLAISPPDTNNEILPGAKGKADLLWRTSRNDNENREH
HGKPGTCFTHCDFSSIYSKDLLPDPAGEEPTNRFLQALVQILLTHVNSTFDRTSKVLDFH
HPHQLKEGLEGFSLELPDRPENLEQLLVDCRDTLKYGVKTGHPRFFNQLSSGLDIIGMAG
EWLTSAANTNIFTFEISPVFILMEEVLLKKLREKVGWPPVEGDGVFCPGGSMSNLYSILL
ARYSYFPEVKMHGMAVIPRLALFTSEHSHYSIRKAAGVLGIGIENVFLVKCDERGKMITS
ELKSGIIRAKAKGLVPFYINATAGTTVYGAFDPLNEIAEICERHGLWMHVDAAWGGGLLM
SRKHAGKLQGIERASSVTWNPHKMMGVPLQCSVILMRQKGLLQDCNQLCAEYLFQPDKHY
DVAYDTGDKSIQCGRHVDVFKLWLMWKAKGSEGFGSQVNQCLENADYLFNKLENRADFEL
VFKNKPEHSNVCFWYIPHSLRKMSRGLEWNKKLHEVAPKIKTKMMEEGMVMVGYQPLGEK
PNFFRCVFSNPATTREDVDFLVDEITRLGQDL
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgttaccagccgtgttggctgaaataagaatgactccctcttctactattaaactgtca
cctgttgaagtgctgatggataagcctatgcataactttgttcccaaccaattggtactg
atcaggagtttgaagccggtcaaggtcggagagccgaagtatctgggcccagcaacggtc
atcgcactcagtgtgaagctccgggtgttgagtctgaacaactccctgtgcaactggata
ctgggctttttaactggcaggcgtcaggtggtcagaataggctgcaacatctcctctccc
ttgtccctcaacaacggggccccgcagggttgcgttctgagccctctcctgtactccctc
tacactcatgactgtgtagctacgcacagcaccaatgccatcgtgaagtttgccgatgac
acgacggttgtaggcctgatcacggacagcaatgagggggcctacagggaggaggtgcac
actctgacacattggtatcaggagaaccacctcttactcaacaccactaagaccaaggag
atcatcgtggacttcaggaggcaggagagggaccccacccccatcaccatcagcgggaca
ccggtggagcgggtcactagctttaagtttctcggtgtccatatcaccgaggatctcaca
tggaccagtcacactaatgcagtggtgaagaaggcccatcagcgcctcttcttccttaga
cggctgaggaagttgaggatgaaccagaacatcctcaaaaccttctacacctgcgcagtg
agagcatcattactggctatatcacctcctgacaccaacaatgaaatactccctggggcg
aagggcaaagctgacttgctgtggagaacaagtagaaatgacaatgagaacagagagcat
catgggaaacctggaacctgctttacacactgtgactttagtagcatctacagcaaagac
ttgcttcctgaccctgctggagaggaacccacaaacagattccttcaggcgctggtgcaa
attcttctcacacacgtcaactccacattcgaccgtacctccaaagtgcttgatttccac
catcctcaccaacttaaggaaggcctcgagggattcagtttggagctccctgataggccg
gaaaatctggaacagctcctggtggattgcagggacacattaaaatatggggtcaaaaca
ggtcatccacgttttttcaaccagctctcctcggggcttgatatcattggcatggctggt
gaatggctcacatcagccgctaacacaaatatattcacttttgaaatatccccagttttc
atcctcatggaggaggttttgctgaagaaattgcgggagaaagtgggctggccacctgtg
gaaggagatggtgttttttgccctggtggttccatgtccaacctgtacagcatcttgctg
gctcggtacagttacttccctgaggtgaagatgcatggaatggcagtgattccaagactg
gcattattcacctctgaacacagtcactactctatcagaaaggcagcaggagttcttgga
atcggaatagaaaatgtgttccttgtaaaatgtgatgagagaggcaaaatgataacctca
gaactaaaatcaggcatcatcagggcaaaagcaaagggcttggtgccattctacatcaat
gccacagcaggaactactgtctatggtgcctttgatccactcaatgaaattgctgaaatc
tgtgagaggcatgggctctggatgcatgttgatgctgcatggggtgggggtctgctcatg
tccaggaagcatgctggaaaactgcaagggattgagagagcatcttctgtgacatggaac
cctcacaaaatgatgggagttcctctacagtgttcagtcatcctcatgaggcagaagggg
cttctacaggattgtaaccagctctgcgccgagtacctgttccaacctgacaaacactat
gatgttgcctatgacacgggggacaagtccatccaatgcggtcggcacgtggatgttttc
aagctgtggctcatgtggaaggccaagggttctgagggttttgggtcccaagttaaccag
tgtttagaaaatgctgattatctgttcaacaaactggagaacagagctgactttgagctt
gtctttaaaaacaaaccggaacacagcaacgtctgcttctggtacattccacatagccta
agaaagatgtcccgtggcctggagtggaacaagaaactacatgaggtggcacctaagata
aaaaccaagatgatggaagagggaatggtgatggttgggtaccagccacttggagagaag
ccaaacttcttccgatgtgttttctccaacccagccaccaccagagaagatgtggacttc
ctggtagatgagatcacacgtttggggcaagatttgtaa

DBGET integrated database retrieval system