KEGG   Scleropages formosus (Asian bonytongue): 108923435
Entry
108923435         CDS       T04919                                 

Gene name
parp3
Definition
(RefSeq) protein mono-ADP-ribosyltransferase PARP3
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
sfm04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108923435 (parp3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108923435 (parp3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108923435 (parp3)
   03036 Chromosome and associated proteins [BR:sfm03036]
    108923435 (parp3)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108923435 (parp3)
Enzymes [BR:sfm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     108923435 (parp3)
DNA replication proteins [BR:sfm03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     108923435 (parp3)
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    108923435 (parp3)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     108923435 (parp3)
SSDB
Motif
Pfam: PARP PARP_reg WGR
Other DBs
NCBI-GeneID: 108923435
NCBI-ProteinID: XP_018589688
LinkDB
Position
22
AA seq 531 aa
MPPKRKAASAAKAGGKKIKEEAAGPKDAFRTAKEALKVAAPKEKGKRKADACFEFRYGGA
EVYEDYDCMLNQTNVGQNNNKFYVIQVLQTGDGQFYCWTRWGRVGETGTFKAPGSYASPE
KAISEFEKKFKDKTKNKWCDRENFVSHPGKYTLIEVDGDQDAEIRADAVDGSVSRVVKNI
LPCSLDSSTQKLIELIFSNDMFKEAMEHMNLDIKKMPLGKLSKAQIAKGFEVLEELEEAL
KKKGKKADLENLSSRFFTIIPHNFGRQKPPVIDTSEILEKKKEMLLVLADIEIAQGLKAE
TEKIKEEMVEDVPHLADRNYSSLKCNLTLLGKDTEDYKIIETYLKATEAGYKLSIIDIWK
VDRHNEAERFKEHEGMDNRRLLWHGTNVAVVAAILKSGLRIMPHSGGRVGRGIYFASENR
MSAGFVRTSKGTGVMFLNEVCLGEEYTITRDDSSLRSPPKGYDSVVARGQCEPDPSKDIS
ITIDGKRVAVPQGPPLEQPQYKNSFFYNSEYLIYKESQCRIRYLLELKFPY
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgcctccaaagagaaaggcagcttcagctgcgaaagccggtgggaagaagatcaaagag
gaggctgctggaccaaaggatgctttcaggactgctaaagaggcgctgaaggtagcggca
ccaaaggaaaaaggcaagcgaaaggcggatgcgtgcttcgagttccggtacggtggggcc
gaggtctatgaagattacgactgcatgctcaaccagaccaacgtcggtcagaacaacaac
aagttctatgtcattcaagttttacaaacaggagatggacagttctactgctggacaaga
tggggtagagtgggagaaacgggtacattcaaggcacctggaagctatgcaagtcctgaa
aaggcgatcagcgagtttgagaagaagttcaaggacaagacgaaaaacaagtggtgtgat
agggagaattttgtttctcatcctgggaaatacacgcttatagaggtggatggagaccag
gatgcggagatcagggcggatgcagtcgatggctcggtgtccagagtggtgaagaacatc
cttccctgttcactggacagttccacacagaagcttattgaactcatcttcagcaatgac
atgttcaaagaagccatggaacacatgaacctggacattaaaaagatgcctcttggaaag
ctgagcaaggctcagatcgccaaaggctttgaagttctggaggagctagaggaggcccta
aagaagaaaggcaagaaggccgacctcgaaaacctctcctccaggttcttcaccatcatc
ccacacaactttggccggcagaagcctccagtcatagacacttcagaaattttggaaaaa
aagaaagagatgctgttggtgttggctgatatcgaaattgctcaaggtctcaaagcagag
actgagaaaatcaaagaggagatggttgaagatgtcccccacctagctgatcggaattat
tcatcattaaaatgcaatctcactctactgggcaaagatacagaggattataagataata
gaaacatacctgaaagcgacagaagcgggatacaaactgagtattattgacatatggaaa
gtagacaggcataatgaggcagagcgattcaaggaacatgaaggaatggacaacaggcgg
ctgctgtggcatggaaccaatgtggctgtggtagctgccatcctcaaaagtggcctgagg
attatgcctcattccggtggacgcgttggcaggggcatctattttgcttctgagaacaga
atgtctgcgggctttgtacgtacatccaaaggcactggtgtgatgttcctcaatgaggtc
tgccttggggaggagtacaccatcaccagagatgactcgagcctcagaagccctcccaag
ggttacgacagtgtggttgctcgtggacagtgtgaaccagatccctctaaggacatctcc
atcaccatcgacggtaagcgtgtggctgttccacagggaccccctcttgaacaaccacag
tataaaaacagtttcttttacaacagcgagtatctcatctacaaggagagccagtgtcgc
atcagatatctcctggagctcaagttcccatattag

KEGG   Scleropages formosus (Asian bonytongue): 108923980
Entry
108923980         CDS       T04919                                 

Gene name
parp1
Definition
(RefSeq) poly [ADP-ribose] polymerase 1
  KO
K24070  poly [ADP-ribose] polymerase 1 [EC:2.4.2.30]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
sfm04210  Apoptosis
sfm04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108923980 (parp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108923980 (parp1)
   04217 Necroptosis
    108923980 (parp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108923980 (parp1)
   03036 Chromosome and associated proteins [BR:sfm03036]
    108923980 (parp1)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108923980 (parp1)
Enzymes [BR:sfm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     108923980 (parp1)
DNA replication proteins [BR:sfm03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     108923980 (parp1)
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    108923980 (parp1)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     108923980 (parp1)
SSDB
Motif
Pfam: PARP PARP_reg zf-PARP WGR PADR1 BRCT BRCT_2
Other DBs
NCBI-GeneID: 108923980
NCBI-ProteinID: XP_018590573
LinkDB
Position
1
AA seq 1013 aa
MADAQDDKLYKAEYAKSGRASCKKCKENIAKDSLRMAIMVQSPMFDGKVPHWHHFSCFWL
RAGVQSPAEISGFSDLRWEDQEKVKKAIESGGASGGKGEQKGGVKGEKTLNDFAVEYAKS
NRSTCKGCEQKIEKDQIRVSKKAVDPEKPQLGLIDRWYHTACFVARREELAFKPEYTASQ
LKGFATLRAEDKEELKQRLPAVKTEGKRKTDETDGQGVSKKQKKEKEEKQEKQMKEQSQL
IWSIKDKLKKFCSINDMKELLIANGQEVPSGESNVVDSLADCMAFGALKPCEECQGQLVF
KSDAYYCTGNISAWTKCVVKTQAPNRKDWVTPKEFHELPFLKKFKFKRQDRVLPKLSSTV
PTNSAPTTSSSNSIPASTCQPVLSDKPLSGLKVLTVGKLTKNKDELKAAIEELGGKVTGT
ATKANLCVSSKKEVEKMSKKMEEVKDAGVRVVSEDFLTDVKSSGKDLQDLISLHGVSTWG
AEIKLEAPAPTSSAAMPCKSSGAGKSMGRVKEEEGGSKSKKMKLTVKGGAAVDPDSGLEN
CAHVLDQNGKIFSATLGLVDIVRGTNSYYKLQLLEDDVQKRYWVFRSWGRVGTTIGGNKL
EKFYDKNSAMDNFRSLYEDKTGNSWTSTNFTKYPNKFYPLEIDYGQDEDAVKRLTASAGT
KSELSKPVQELIRMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSLLNEVQQAVS
DSVPESQILDLSNRFYTLIPHDFGMKKPPLLNNLDYIQAKVQMLDNLLDIEVAYSLLRGG
TEDNKKDPIDINYEKLKTKIEVVDRSSKEAEVILQYVKNTHAATHNTYTLEVEEIFKVVR
EGEYQRYRPFQDLHNRQLLWHGSRTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMV
SKSANYCHTSQSDPVGLILLGEVALGNTLELKKASHITKLPKGKHSVKGLGRTAPDPSAS
AMLDGVQVPLGKGINTNIEDTSLLYNEYIVYDVAQVNLKYLLKIRFNYQTSLW
NT seq 3042 nt   +upstreamnt  +downstreamnt
atggcggatgcgcaagacgacaagctttacaaagcggaatacgcaaaaagcggacgggca
tcttgcaagaagtgcaaggaaaatatagcgaaagactcgctgcgtatggcgataatggtg
cagtctcccatgtttgatggtaaagtcccccactggcaccacttctcctgcttctggctt
cgtgctggggtccagtcccccgctgaaatctccggcttttctgacctccgctgggaggac
caagaaaaggtcaaaaaggccattgagagtggaggtgcttcaggaggaaagggtgaacag
aagggaggagttaaaggagagaagacactgaatgactttgcagtggagtatgctaagtca
aacaggagcacctgcaagggatgtgaacagaaaattgagaaggaccagatccgtgtgtct
aagaaggctgtggacccagagaagccccagcttgggctcatagatcgctggtaccacaca
gcgtgctttgtggctcgacgcgaggagctggctttcaagccggaatacaccgcaagccaa
ctcaagggctttgctacgctcagggctgaggacaaggaggaactgaaacagaggttgcct
gctgtcaagaccgaggggaagagaaaaacagatgagactgatgggcaaggagtttctaaa
aaacagaaaaaagaaaaagaagagaaacaagagaaacaaatgaaggagcagagccagctg
atatggagcatcaaggacaagctgaagaagttctgctccattaatgacatgaaggaactg
ctcattgccaatggacaggaggtcccttcaggagaatcaaatgttgtggacagcttggca
gactgtatggcatttggggctctgaaaccatgtgaggaatgccagggtcagctggtattc
aagagtgatgcatactattgcactggaaacatctctgcttggaccaagtgtgtcgtcaaa
acccaggcaccaaaccgcaaggactgggtaacccccaaggaattccatgagctccctttc
ctgaagaagtttaagttcaaacgtcaggacagagtgcttcccaaattgtcatcaacagtt
ccgaccaattcagcgccaaccacaagttcttccaattccatccctgcatccacatgtcaa
cctgtgctatcagacaagcccctcagtggtctaaaggtgctgactgtggggaagctgacg
aagaacaaggacgagctaaaggcagccattgaagagctgggtggaaaggtcactgggact
gctaccaaagccaatctctgtgtcagctctaagaaggaggttgagaagatgagcaagaag
atggaagaggtgaaggatgctggggtgcgtgtggtgtcagaggacttccttacagatgta
aagtccagtggcaaggacctgcaggatctgatctctcttcatggtgtctccacctggggt
gctgagatcaaacttgaagcacctgctcccacctcttcggctgctatgccttgcaagtcc
agcggagctgggaagagtatgggcagagtaaaggaggaggaaggtggcagcaagagtaag
aaaatgaaactgacagttaaaggaggagcagctgtagatccagattctggtctggaaaac
tgtgcacatgtcttggatcagaatgggaagatcttcagcgccactcttggtctggtggat
atagtcagagggaccaattcttactacaaattgcagctcctggaggatgatgtgcagaag
cgttactgggtgttcagatcttggggccgtgtgggcaccaccattggaggaaacaaactg
gagaagttctatgacaagaactctgctatggacaatttccgcagtctctatgaggataaa
actggaaactcatggacctcaactaattttacaaagtatcccaacaagttctaccctcta
gagatcgactatggacaggatgaagacgctgtgaagaggctgacagcaagtgctggaaca
aagtctgagctgtcaaaacctgtacaagagctgatcaggatgatctttgatgtagagagc
atgaagaaagcaatggttgagtttgagattgacttgcagaagatgccccttggaaagctg
agcaagaggcagatccaaagtgcctactctctgctgaatgaagtgcagcaggcagtgtct
gacagtgtgcctgagtcccaaatcctggatctgtccaatcgcttttacaccctgatacct
catgactttgggatgaagaaaccaccactgttaaataaccttgactacattcaggctaaa
gtccagatgttggataacctgctggatattgaagtggcctacagccttcttcgtggtgga
acagaagacaataagaaggacccgattgacataaactatgagaaacttaaaaccaaaatt
gaggttgttgacagatcttctaaggaagccgaagtcatcttgcaatatgttaaaaataca
catgcagccacccataacacctatactcttgaagtagaagagatcttcaaggtggtgaga
gaaggcgagtaccagcgctacaggcccttccaggatctgcacaaccggcagctgctgtgg
catggctcacgtaccaccaactatgctggcattctgtctcagggtctacgtattgcaccc
cctgaggcccctgtgacaggttacatgttcgggaaaggcgtgtactttgctgacatggtg
tcaaaaagtgccaactactgccatacctctcagtccgaccctgtggggctcattctgttg
ggagaagttgccctcggcaacacgcttgaactaaagaaagcgtcacatattacaaaattg
ccaaagggtaaacacagcgtgaaaggtttaggaagaactgctcctgaccccagtgcctcc
gcgatgttagatggtgtgcaagtgcctctgggtaaaggcatcaacaccaatatcgaggac
actagtctgctgtacaatgaatatattgtgtatgatgttgcacaggtgaacctgaaatac
ttgttgaagatcagattcaactaccagacgtccctgtggtga

KEGG   Scleropages formosus (Asian bonytongue): 108937870
Entry
108937870         CDS       T04919                                 

Gene name
parp2
Definition
(RefSeq) poly [ADP-ribose] polymerase 2 isoform X1
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
sfm04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108937870 (parp2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108937870 (parp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108937870 (parp2)
   03036 Chromosome and associated proteins [BR:sfm03036]
    108937870 (parp2)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108937870 (parp2)
Enzymes [BR:sfm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     108937870 (parp2)
DNA replication proteins [BR:sfm03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     108937870 (parp2)
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    108937870 (parp2)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     108937870 (parp2)
SSDB
Motif
Pfam: PARP PARP_reg WGR
Other DBs
NCBI-GeneID: 108937870
NCBI-ProteinID: XP_018613580
LinkDB
Position
1
AA seq 559 aa
MRRTRSSRTQPKNVADEQSESAEVNNIKEEQPVAKKKRGGGTSQKESREAQSDEEDDKEV
VKTMVMKGKAPVDSECTAKLGKAHVYNEGDDIYDVMLNQTNLQFNNNKYYLIQLLQDDNM
KNYTVWMRWGRVGKVGQHSLMSFGGDLEKAKDVFKKKFFDKTKNNWDSRAQFEKVAGKYD
MVFMDYMASSKEEESQGPSKASLPKKTCQLDSKVQSLLDLICDIRAMEECVLEMKFDTKK
APLGKLTVEQIKAGYASLKRIEECLKRKGNKKELLEACNQFYTRIPHDFGLRTPPLIQTE
QELKEKIALLEALSDIQIAVKMVQSSVESLEHPLDRQYKSLRCMLEPLPRNSHEYKVIEQ
YLHSTHAPTHKDYTMTVLDIFTVEREGEKERFSTQLHNRMLLWHGSRLSNWVGILSQGLR
VAPPEAPITGYMFGKGIYFADMSSKSANYCYASQKNNTGLLLLCEVALGDCNELLTADYE
ASKLPVGKHSTKGLGQTAPDPRNAVVLDGATVPLGPCMKTGVGQSGGYTLLYNEFIVYDP
SQIHMRYLLKVQFNYSSLW
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgagacgcacgagaagttctcgcacccaacccaaaaatgttgcggatgagcagtcagag
agtgctgaagtgaacaacatcaaggaagagcagccagttgccaagaagaagaggggtgga
gggacgagccagaaggagagcagggaagctcagagtgatgaagaggatgacaaagaagta
gttaagaccatggtgatgaagggaaaggctccagttgactcagaatgcactgctaaatta
ggaaaggctcacgtttacaatgaaggagatgatatctatgatgttatgttgaaccagacc
aaccttcagtttaataacaacaagtactacctgattcagctgctacaggatgacaacatg
aagaactacactgtgtggatgcgctgggggagagttggaaaagttgggcaacacagttta
atgtcctttggtggagacctcgaaaaggccaaagacgtgtttaagaaaaagttctttgac
aagacaaaaaataactgggacagccgggcacagtttgaaaaagtagcaggaaagtacgac
atggtgttcatggattacatggcgagcagcaaggaggaagagagtcagggtccttcaaaa
gcttccctgcccaagaaaacttgccagctggacagtaaggtgcagtcccttttagatctc
atttgtgacatcagagccatggaggagtgtgtgctggagatgaagtttgacaccaagaaa
gcacctttgggtaaactgacagtggagcagatcaaggcagggtatgcctcattgaaaagg
attgaggagtgtctgaagaggaagggtaacaagaaggagctcttagaagcctgcaaccag
ttctacacccgcatccctcatgactttgggttgcggacccccccactcattcagacagag
caggagctgaaggagaagattgcattgctggaggctctcagtgacatacagatagcagtg
aagatggtccagtctagtgttgagagcttggagcaccctctggaccgacagtacaagtcc
ctgcgctgtatgctcgaacccctgccacgtaacagtcacgagtacaaggtgatagagcag
tacctccactccacccacgctcctacccacaaagactacaccatgaccgtgctggacatc
ttcacagtggagcgagagggagagaaggagaggttcagcacacaacttcacaacaggatg
ctgctgtggcatggttctcgcctttccaactgggtgggcatcctcagccagggtctcaga
gtcgcccctccagaggcccccatcactggatatatgtttggaaagggcatctattttgct
gacatgtcctcaaaaagtgccaactactgctacgccagtcagaagaacaacacaggactc
ctcttgctgtgtgaggttgccctgggagactgtaacgagctgttgacggcagactacgaa
gcgtccaaattgcctgtggggaagcatagcaccaagggtcttgggcagactgcccctgac
cccagaaatgctgttgtactggacggcgccacagtgccgttgggcccctgcatgaagaca
ggggttggccagagtggtggctatactctcctttacaatgagttcattgtttacgaccca
tcccagatacacatgagatatctcctgaaggtgcagttcaactactcctccttgtggtag

DBGET integrated database retrieval system