KEGG   Scleropages formosus (Asian bonytongue): 108923532Help
Entry
108923532         CDS       T04919                                 

Definition
(RefSeq) structural maintenance of chromosomes protein 6-like isoform X1
  KO
K22804  structural maintenance of chromosomes protein 6
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108923532
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     108923532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SMC_N AAA_23 AAA_21 AAA_15 AAA_29 Uteroglobin
Motif
Other DBs
NCBI-GeneID: 108923532
NCBI-ProteinID: XP_018589848
UniProt: A0A1W4YNA3
LinkDB All DBs
Position
15
AA seq 1072 aa AA seqDB search
MSKRRGIFPCGSRPSKTPRNKDVDDGNTGDLEQDPEDPGESSPPSTSTAGDIGIIESITL
MNFMCHHSPKTLHFGPNVNFIVGNNGSGKSAVLTALIVGLGGKAIVTNRGQSLKGFVTNG
ERYADIKIQLRNRGTDAYKRDDYGNSITVEQRLTSDGCRTYKIRSEIGQIVSNKKEELTN
ILDHFSIQIDNPVSVLNQEMSKQFLYSKSEADKYKFFMKATLLEQMKLDYIHIKQTKELT
RDRVGTQEKYLRDLRKKYLQKKERYDSLSSLDEMKKKLEDLQHEMAWSLVAEQERQIQQL
QEQIENAECSNPYEDNVKMFQIKVSQAQRKCQEIQQKLDTVKGKEENLEEERRKLREDLT
TKSKAQKEQEVVVFRAKNKLKQLEAYQVLLQEKIQTLRESAHPSREAEILERQSKISTLR
QQLDRHENEGKELNRQITDKQQVLMKAKEESGKLRLEEKNIQASVESKQRRKSQLMASRS
NRLRRFGNQFPELLMAIDNAHTEGRFLKKPIGPVGACISLKDPSLAVAVESCLRNFTKTF
CCHSHKDEKVLEALMSRYFPRIYRPGIIVMPFADQVYNTAGRCVKHPEFPSVLDALVIPS
PVIANCLIDMRSIETVLVIKDRVTARRVMQQGKPPRNCREAFTSEGDQVFADRYYSAESS
MAKYLGADVEAEIRLVDSELENATAQLSRFHAHINSVTQNIHHMEVELQSLMVRSKKNQA
CITRVKATIVELENTEELQRDDISSLEDEAQENLQKAEAVKHSLREAEEELDRLKALMTE
THSKHKEMKSEIEKLQEQAGSLPEEFHSAEAECNTLECTLNKWEMEQREHEENLQAMRSE
LISKKEEVQELETTARLICPERRPVERSIESVNAEMTCFRQRILEQQSQHGDQEQIIREY
AEALKSYQEAANQVKDLKRFIDCLDNIMNDRLMRFKMMRRSIAVRCKLYFSNFLIKLNCS
GSMIFDHTKETLSISVKPPGCEDDSVNDVRSLSGGERSFATVCFILALWEITESPFRCLD
EFDVYMDMHNRRISMDLLVQLSERQYGRQFIFITPQNTSTLPESNLIKIINL
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaggagaggcatcttcccctgtggaagcagacccagcaagacaccaaggaac
aaagatgtggatgatggtaacacaggggaccttgaacaagaccctgaagaccctggagag
agctcccctcctagcacttcgacagctggagacatcggtatcattgaaagtatcactttg
atgaactttatgtgtcaccattctccaaagaccttgcattttggacctaatgtgaatttt
atagttggcaacaatggaagtggaaaaagtgcagttttgacagctctcattgttggcctt
ggtggaaaggcaatagttacaaacagaggacagtcactgaagggctttgtgacaaacgga
gaaaggtatgcagacataaaaatacagttacgaaacagaggaacagatgcatacaaaagg
gacgattatggcaattctattacagttgagcagcggctcaccagtgatggatgtcgaacg
tacaaaatcaggagcgagatcggacagatagtttccaataagaaagaagagctaactaac
attttggaccattttagcattcagatagacaatccagtgtcagtcctcaaccaagaaatg
agtaaacagttcctctactcaaaaagtgaagctgataaatacaagtttttcatgaaagcc
accttgctggagcagatgaaactggattatatccacatcaagcaaacgaaagaattaact
cgagatcgggttggcacacaggagaagtatctcagagatctcagaaagaagtatctgcag
aaaaaggaacgttatgacagtttgtcttcgctggacgagatgaaaaagaagctggaggac
cttcagcatgagatggcctggtctctcgtagctgagcaagagcgacagattcagcagctt
caagaacagattgaaaatgcagagtgcagtaatccatatgaagacaacgtaaagatgttt
cagattaaagtcagtcaagctcaaagaaaatgccaggaaatccagcagaagcttgacaca
gtgaaaggcaaggaagagaatttggaggaagagaggcgcaaattgagagaagatctaaca
acgaaaagtaaagcccagaaagagcaagaggtggtggtgtttcgtgccaagaataaactg
aaacaattagaagcatatcaagttcttcttcaggaaaaaattcagacactaagagagagc
gcacatcccagtcgcgaggcagagatcttggaacggcaaagcaaaatatcaacactcaga
cagcagctggacaggcatgagaatgaaggcaaagagctgaatcggcagattacagacaag
cagcaggtgctcatgaaagcaaaggaggaatctggcaagttaagacttgaagagaagaat
atccaggcttccgtggagtcgaaacagaggaggaaaagccagctgatggccagcaggtcg
aacaggctgcggagatttgggaatcagttccctgagttattgatggctattgataatgca
cacactgagggacgttttcttaagaaacccatcggtcccgtaggtgcctgcatcagcttg
aaggatccaagtctggctgttgcggtcgagagctgcctgcgaaacttcacaaaaaccttc
tgctgtcacagtcacaaggacgagaaagtccttgaggctttgatgtcccgctactttccc
agaatctatcggccaggaattattgtgatgcctttcgcagaccaagtgtacaacactgca
gggcgctgcgttaagcatcccgaatttccttcggtattggacgcccttgtgattcctagt
cctgtcatcgctaactgtctcattgatatgaggagcatagagaccgttttggtcatcaaa
gacagggtcacagcacgaagagtcatgcaacaaggcaaaccacccagaaactgccgcgaa
gcgttcaccagcgaaggagaccaggtctttgccgaccgttactactctgccgaatcaagt
atggccaagtatcttggggcagatgtagaggcagaaattcgcctggtggactcggagctg
gagaacgccacggcccagctctccaggttccacgcacacataaattctgtcacgcagaac
attcatcacatggaggtggagctgcagagcctcatggtcaggtcgaagaagaaccaggct
tgtattacccgagtgaaagccaccattgtggaactggagaacactgaagaactgcagaga
gatgacatcagctccctggaggatgaggcccaggaaaatttgcagaaagctgaagcagtg
aaacacagcttaagggaagctgaagaagagctggacaggctgaaagccctcatgacagaa
acccattccaagcacaaggaaatgaagagtgaaatagaaaagctgcaggagcaggctggg
tctttaccggaggagttccacagtgcagaagcagagtgtaacacacttgagtgcaccttg
aacaagtgggagatggagcagagagaacatgaagagaaccttcaagccatgaggagtgag
cttatctccaaaaaagaggaagttcaggaacttgagacaacagccagactgatctgccct
gagcggcgtccagtggaaaggagcattgagtctgtcaatgcagaaatgacctgcttccga
caaaggattcttgagcagcagagtcaacacggtgaccaggagcagatcatcagggagtac
gctgaggccctgaagagctaccaggaggctgccaaccaagtcaaagatctgaagagattc
attgactgtcttgacaatataatgaatgacaggttgatgcgcttcaaaatgatgcgaaga
tccattgctgtgaggtgcaagctgtacttcagcaatttcctgataaagttaaactgcagc
ggatcaatgatatttgaccataccaaggagaccctctctatctcggtgaagcccccgggc
tgcgaggatgatagtgttaacgatgtgcgctcactctctggtggggagcggtcctttgcc
acagtctgtttcatcctcgcactgtgggagatcactgagtcacctttcaggtgtctggat
gagttcgacgtctacatggacatgcacaatcgccgtatttcgatggacttgcttgtgcag
ctgtcagaaaggcaatatgggcgtcagtttattttcataactcctcaaaatacaagcacc
cttcctgagagcaacctgattaagattattaacctttga

DBGET integrated database retrieval system