KEGG   Scleropages formosus (Asian bonytongue): 108923698Help
Entry
108923698         CDS       T04919                                 

Gene name
smarcc1
Definition
(RefSeq) SWI/SNF complex subunit SMARCC1 isoform X1
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sfm03021]
    108923698 (smarcc1)
   03036 Chromosome and associated proteins [BR:sfm03036]
    108923698 (smarcc1)
Transcription machinery [BR:sfm03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     108923698 (smarcc1)
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic Type
  Chromatin remodeling factors
   BAF complex
    108923698 (smarcc1)
   PBAF complex
    108923698 (smarcc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_2 SWIRM SWIRM-assoc_3 SWIRM-assoc_1 Myb_DNA-binding Myb_DNA-bind_6 Chromo BRCT_2 BRCT DUF919
Motif
Other DBs
NCBI-GeneID: 108923698
NCBI-ProteinID: XP_018590149
LinkDB All DBs
Position
18
AA seq 1137 aa AA seqDB search
MAAAAAAATAAGGTSSWGSTGAQGASGMSVFRKKDGGPSSKYWESGETVSQLEPVRLWVG
KHYKKYVQADSPSSKSLAGLVVQLLQFQEDAFGRRVNNPALTKLPAKSFLDFKPGGALCH
ILGSVYKFRSEQGWRRFDLQNPSRMDRNVEMFMNVEKTLVQNNCLTRPIVYIASDMDQKQ
AVKLKDIIKRHQGSITEDKSKATHHIYPSPGQLDEEEWLRPVMRKDKQVLVHWGMYPDSY
DTWVPANDVEGDVEEPPSQDKPWKVHAKWVLDTDAFNEWMNEEDYEVDENRKPVSYRQRI
FLREEESSRTPDRKDRKAAASSRKRRRSPSPPSESRKKGNKKGSSGPGWKRRGHREEEEP
EEDVSKDMEDPSPVPNMEEVTLPKNVNPKKDSENTPVKGGTVADLDEQEDDSMVSGGKED
EESGKTEGSRLLDSSEDNVTEQMHHIIIPSYAAWFDYNSIHEIERRALPEFFNGKNKSKT
PEIYLAYRNFMIDTYRLNPQEYLTSTSCRRNLTGDVCAIMRVHAFLEQWGLVNYQVDAES
RPLPMGPPPTSHFTVLADTPSGLMPLHLRPPQIPASQQMLNFPEKGKEKQMDLQNFGLRT
DVYSKKNPKTKGGREWTEQETLLLLEGLEMYKDDWNKVSEHVGSRTQDECILHFLRLPIE
DPYLESPDTTLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVAAAAAKAALEEFSRVRE
EVPAELVEAHVKKVQEAARTTGKLDPAFGLESSGIAGTAPEEPEKTESAEAEKMDTDTDS
QQVAKAESRDEAERPGESAEGEHVNSETTEPQGEKEEGESEGAEEGESEGVEEEKDKVEA
MDTEAPKEVDGDESQKKLLPDVGEGNIATAAAAALASAATKAKHLAAVEERKIKSLVALL
VETQMKKLEIKLRHFEELETIMDREKEALELQRQQLLTERQAFHMEQLRYAEMKARQQME
QQQAAAAAAAAAAAAAHNPGGHPGGHPGTLPAGHPGGHSAGHPGAHPGGHPGGHHGPPPG
MHPHPAPGYPPMHHPMAPYHPPHAGPMGGPAQPMPSRMMPGGPQGGQPQPNMPPMMGPRH
PGAPNGLYATPPMSQPDGLPPAPVGPPVGAPVGPPVGPPAGPSVGPSIGPASRPPEN
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggctgcggcggcgacggcagcgggtggaacgagttcgtggggctcgacg
ggcgctcagggagccagtggaatgtctgttttcaggaagaaggacgggggtccgtcctcg
aaatactgggagagcggagagacggtgtcccagctggagcccgtgcgcctatgggtcggg
aaacactacaaaaagtatgtccaggcagactctccatcgagcaagtcactggctggcctg
gtagtgcagctgctgcagttccaggaggatgcgttcggcaggagggtgaacaacccagcc
ctcaccaagctgcctgcaaagagcttcctggactttaagccaggaggtgcactgtgtcac
atcttgggatccgtctacaaattcaggagcgagcagggctggcgacggttcgacctgcag
aacccctctaggatggataggaacgtggagatgtttatgaatgtggagaagacactcgtg
cagaacaactgccttacgcgccctatcgtgtacatagcgtcagacatggatcagaaacaa
gctgtgaagctgaaggacattatcaagaggcaccagggctccatcacagaggacaaatcc
aaggccacacaccacatctatccatccccaggacagctggatgaagaagagtggctccgc
cctgtgatgcgcaaagacaagcaggtgctagttcactggggcatgtaccctgatagctat
gatacttgggtgccagccaatgacgtagaaggagatgtggaggagccacccagccaggac
aagccctggaaagttcatgctaagtgggttctggacacggacgccttcaatgaatggatg
aatgaggaggactatgaggtagatgagaacaggaagccagtgagctaccgtcaacgcatc
ttcctacgagaggaagagtcttcccgtacacctgatcgcaaggaccgcaaggcagccgcc
agcagcaggaagaggaggcgctcaccatcgcccccctcagaatcacgcaaaaagggcaac
aagaagggcagttctggccccggctggaagcggcgaggccatcgtgaagaggaggagcca
gaggaagatgtttccaaagacatggaggacccatctcccgtgcccaacatggaggaggtc
accctgcccaagaatgtgaaccctaagaaggacagtgagaacacccctgtgaagggtggt
acagtggctgatctggatgaacaggaagatgactccatggtttccggtggcaaggaagat
gaggagtcaggcaaaacagaggggagccgtcttctggattcgagcgaggacaatgtgaca
gagcagatgcaccatataattatcccaagctatgccgcctggtttgactacaacagcatc
catgaaattgagaggcgtgctctgccagagttcttcaatggcaagaacaagtccaaaact
ccggagatatacctggcctataggaatttcatgattgacacataccggttgaaccctcag
gagtacctcacctccacgtcctgccgcaggaacctcaccggggatgtatgcgcaataatg
agggttcatgccttcctggagcagtggggtctggtgaactatcaggtggatgcggagagt
cgacccctgccaatgggtcctccgcccacctctcatttcactgtgctggctgatacacca
tcaggcctgatgcccctgcacctccgcccaccgcagattccagcctcccaacagatgttg
aacttccctgagaaagggaaggagaaacaaatggacttgcagaactttggcctgcgcact
gacgtgtactccaagaagaacccaaagactaaaggtggcagggaatggactgaacaggaa
accctgcttcttctggagggcctggagatgtacaaagatgactggaacaaagtgtcggag
catgtggggagccgcacacaggacgagtgtatcctgcacttcctacggctgcccattgag
gacccctacctggaaagtccagacaccacactgggcccactggcctaccagcccgtgccc
ttcagccagtcgggaaaccccgtcatgagcaccgtggcatttctggcctctgtggtagac
ccccgtgtggcagccgcagcggccaaggctgctctagaggagttttcacgggtgcgggag
gaggttccggcagagctggtggaggcacacgtcaagaaggtgcaagaggcggcacgcacc
actggcaaactggaccctgcctttgggctggagagcagcggtattgctggaacggcccca
gaggagcctgagaaaacggagtccgctgaggctgagaagatggatacagatacagattcc
cagcaggtagccaaggccgaatcaagagacgaggcagagaggcctggggagtcagcagaa
ggcgagcatgtcaacagtgaaaccactgaaccacagggtgaaaaagaggagggggaaagt
gaaggagccgaggagggagagagtgagggagttgaagaggagaaggacaaggtggaagcc
atggacacagaggctcccaaagaggtagatggggatgagagccagaagaagctgctgcct
gacgttggagagggaaatattgccactgctgcggctgcagctctggcatctgctgccacc
aaggccaagcacttggctgcagtggaagagcggaaaataaagtccctggtggccctgctg
gtggagacccagatgaaaaaactggagatcaagctgaggcattttgaggagctggagacc
atcatggaccgtgagaaggaagcgctggaactacagaggcagcagctcctgacggagcgc
caggcattccatatggagcagttgcgctatgctgagatgaaggctcgccagcagatggag
cagcagcaagctgctgctgctgctgccgccgccgccgccgctgctgcacataaccctggg
ggacaccctgggggacaccctggaaccctccctgctggacaccctggagggcattctgct
ggccatcctggagcacaccctggaggtcaccctgggggccaccatggccccccaccaggc
atgcacccccacccagcccccggctacccacctatgcaccatcctatggccccctaccac
cctcctcatgcaggtcctatgggaggaccagctcagcccatgccaagtcgtatgatgccc
gggggtcctcaaggtggacagccccagcccaacatgccccctatgatgggaccaaggcac
ccaggtgctcccaatggcttgtacgccacccctcccatgtcgcagcccgatgggttgcca
cctgccccagttggaccaccagtgggagcaccagtcggaccaccagtaggaccaccagct
ggaccctctgtgggaccatcaattggtcccgcatcccgtcccccagagaactaa

DBGET integrated database retrieval system