KEGG   Scleropages formosus (Asian bonytongue): 108924104Help
Entry
108924104         CDS       T04919                                 

Definition
(RefSeq) structural maintenance of chromosomes protein 6
  KO
K22804  structural maintenance of chromosomes protein 6
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108924104
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     108924104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SMC_N AAA_23 Laminin_II AAA_21 DUF1797 AAA_29 UvrA_DNA-bind Spc7 Tannase LPP AAA_13 Shugoshin_N GAS
Motif
Other DBs
NCBI-GeneID: 108924104
NCBI-ProteinID: XP_018590789
UniProt: A0A1W4YGT1
LinkDB All DBs
Position
1
AA seq 1094 aa AA seqDB search
MSKRKNSSLSEGNHKRARSAQWEEDEEGDTGPSQASSVTYTSQKTSGEVGIVESISLKNF
MCHSLLGPFSFGSNVNFIVGNNGSGKSAVLTALIVGLGGKAHTTNRGSSLKGFVKEGESS
ADVSITLRNRGQDAYKPEVFGESIIVELRLSSEGLRTYKLKSKIGQLVSSKKDELVSILD
HFNIQVDNPVSILTQEMSKHFLHSKGEGDKYKFFMKATQLEQMKEDYTYIMKTKNMTQNT
VEKHEECLEDLKRKYLEKEDKYKSLASLDEMHAKLEELQNLMAWALVTEMEKEIKPMRER
IVGEENATIKYDQKVEEWKLEVVEAEKQYKQTHDQLDSISQRVQELQPQCSELRDEVQNR
SKAFKEAEATFHRSKTNLRDLERDKEQLVKRIDELKCSILQLTGAESRERAERISKLQSE
LDALNHKDSTLAQQINQFQQVVARGKEELTKMRQEERELHRSVEAKQRDLNAMVASRTDK
IKRFGERMPALLETINEFHRKGHFRKKPVGPVGFCIRLKDPELALAVESCLKSLMLAFCC
DNFKDEKTLQSIMSEHYPQGRRPLIIVSEFSSSMYNISGKAAQHPDYPTVLEALEVDNPV
VANCLIDMRAVETVLVIKSNADARRVMQNGRPPVNCREAFTKEGDQVFPNRYYSCEYQRA
QYLSKDLEEQIRYMQSEIENEKAHLSRFRKRMNDIEDDIRSNESLLRSAYDDRKRTKSTI
TKIQMEMADLQNVEEPQSEDLNPLEEELQEICVRISDARQESDEARQKMNERRKAFEEAE
QSYRQHKDIINNVAEEAERIKEELSKCDQEVEKSKHHKKHYEEKRKTHINGIQKLKADLD
VKEKELMASVAKASEICLERLEVKRTAKSIDSEISRLKQKISNQQDQQGDRDEVIRQYQE
ALENYRNIALQVKTLKKFIGLLGKIMNDRHKMYTEMRMYLSVRCKYYFDSMLSQRGYTGK
MTFDHKNETLSISVQPGEGDKATLSDMRSLSGGERSFSTVCFVLSLWAIAEAPFRCLDEF
DVYMDMVNRRISMDMMLKIAASQRYRQFIFLTPQSMSSLPVNNLIRILRLNDPDRGQTSL
PFGRSNQEEAIYNK
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaggaagaatagctcattaagtgagggtaaccacaaacgagcaaggtccgct
caatgggaagaagatgaggagggtgacactgggccaagtcaggcctcttctgtgacatac
acttcacaaaagacttcaggagaagtgggcatagttgagagcatttccctgaagaacttc
atgtgccattctttgctggggccattttcttttgggtcaaatgtcaactttattgttgga
aacaatggaagtggcaaaagtgcagttctgactgcgcttattgttggccttggaggtaaa
gcacacacaacaaatagaggatcttcactgaaaggatttgtgaaggaaggagaaagttca
gcagatgtttccattacattacgcaacagagggcaggatgcttataaaccagaggtgttt
ggtgagtccatcatcgtggagctgcgactctccagtgaggggcttagaacctacaaacta
aagagcaaaatcggtcagcttgtgtcttcgaaaaaagatgagctggtttccattctggat
cacttcaatatccaggtggacaacccagtgtcaatactgacacaagaaatgagcaagcac
ttcttacactcaaaaggtgaaggcgataaatacaagtttttcatgaaagcaactcagttg
gagcaaatgaaagaggactacacatatatcatgaagacaaagaatatgacccagaataca
gttgagaaacatgaggagtgcttggaggacttgaagcgcaagtatttggaaaaagaggac
aagtacaagagtttggcttctctggatgaaatgcatgcaaagttggaggaacttcagaat
ctgatggcatgggccctggtcactgaaatggaaaaagagataaagcccatgagggagagg
attgtgggtgaagagaatgccaccatcaagtatgaccagaaagtagaggaatggaagctc
gaagtggtagaagcagagaagcagtacaagcaaacacatgaccagctggacagcatctca
cagcgtgtgcaggagcttcagccacagtgctcagagctcagagatgaagttcagaaccgc
agcaaagccttcaaggaggctgaggccaccttccatcgctctaagaccaatctgagggac
ctagagagggacaaggagcagcttgtgaagcgcatcgatgagctcaagtgcagtattctt
cagttaacgggtgcagagagccgggagagggcagagaggatcagcaagctccagtcagag
cttgatgccttgaaccataaagactctacccttgctcagcaaatcaaccagttccagcaa
gtggtggccaggggcaaagaagagctgactaagatgcggcaagaagaaagggagttgcat
cgttctgtggaggctaagcagagggacctcaatgccatggtggctagcaggacagataaa
atcaagcgctttggagagcggatgcctgcgttgcttgaaaccatcaatgagttccatagg
aaaggacatttcagaaagaaacccgtgggtccagtgggattctgcatccgcctcaaagac
cctgagctggcactggctgtagagagctgcctgaagagcctgatgctggccttctgttgt
gacaacttcaaggacgagaagaccctgcaaagcatcatgtcagaacactaccctcagggc
aggaggcccctgatcatagtcagcgagttttccagctctatgtacaatatcagtgggaaa
gctgctcagcacccagattatcccacggtgctagaagctttggaggttgacaacccagtg
gtggcaaactgtctgattgacatgcgtgcagttgaaacagttttggttattaagagcaat
gcagatgcacggcgggtgatgcagaatggccgtcccccagttaactgcagagaggcgttt
acaaaagaaggagaccaggtcttccctaaccgctactactcttgcgagtaccagcgagca
cagtacctaagcaaggatttggaagaacaaatcagatacatgcagtcagagattgagaat
gagaaggcccatctttcaaggttcaggaaacggatgaacgatatagaggatgacatacga
agcaatgaaagtctgctgaggagtgcatacgatgacaggaagagaaccaagagcacaatt
actaagattcagatggaaatggctgatctgcagaatgttgaagaaccccagtctgaggac
ctaaaccctctggaggaggagctgcaggagatctgtgtcaggatcagtgatgccaggcaa
gagagtgatgaggcccgacagaaaatgaatgaaaggaggaaggcctttgaagaggcagaa
cagagctaccggcagcataaagatatcattaacaacgtggcagaggaagcagagcgaata
aaggaagaacttagtaaatgtgaccaggaagtggagaagtccaagcatcacaagaaacac
tacgaagagaaaagaaagacgcacatcaatgggattcagaagctcaaggctgatctggat
gtcaaagagaaggagctcatggcctctgttgcaaaggcatctgaaatctgccttgagcgc
ctggaggtgaagagaacagctaaaagcatagacagtgaaatcagtcgactaaagcagaag
atcagcaatcagcaagaccagcagggggacagagatgaggtcatcagacagtaccaggag
gctttggagaactataggaatatagctctgcaggtgaagacccttaagaagttcattggc
ctcctgggaaagatcatgaatgaccgccacaaaatgtacactgagatgagaatgtatctt
tcagtgcgctgtaagtactactttgactcaatgctgtctcaaagaggatatacaggaaag
atgacctttgaccacaaaaatgagacattgtccatctcggttcaaccaggagagggtgac
aaagcgactttgagcgatatgcgctctttgtcagggggtgagcgttcattctccactgta
tgctttgtgctttccttgtgggccatcgccgaggctcccttccgctgcctggacgagttc
gatgtctacatggacatggttaaccgaagaatatctatggacatgatgttgaaaatagcc
gccagccagcgttacaggcagttcatttttcttacccctcaaagtatgagctctcttcca
gtcaacaacctgatccgaattctccgcctaaatgacccagaccgcggacagacatcactt
ccctttggcaggagtaatcaggaggaggcgatctacaataaatga

DBGET integrated database retrieval system