KEGG   Scleropages formosus (Asian bonytongue): 108924279Help
Entry
108924279         CDS       T04919                                 

Definition
(RefSeq) histone deacetylase 4-like isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108924279
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sfm03036]
    108924279
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     108924279
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     108924279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 108924279
NCBI-ProteinID: XP_018591053
UniProt: A0A1W4YRP2
LinkDB All DBs
Position
Unknown
AA seq 1082 aa AA seqDB search
MLRTIFETECSLSPADGLPGKEQALELLKPSGLNHIPSVDVSAALPLQVPPAAIPMDLRV
EQQFALAPGVTPSDPVRREQQLQQELLALQQKQEIQRQRRTAXXXXAEFQRQHEQLSRQH
EAQLQEHIKQQQDLLALKHQQELLEHQRKMEKHRQEQELEKQHREKKLQLLKNKERGQES
AVASTEVKMRLQEFVLNKKKALAQRNLNHCVPGDPRFWYGKTQHSSLDQSSPPQTGMSAT
YNHPVLGMYDPKDDFPLRKTASEPNLKLRSRLKQKVTERRSSPLLRRKDVPVNTAKKRSL
DMAVSREGFLNICFAESACSSAPGSGPSSPNNSSSNITNENGIASSISGSTAEPSLVQRL
ASREGPASQLSLYTSPSLPNITLGLPATGPSSVASGQQDGDRLAMPSLQQGLPLTTPFIP
GSHLPSYLSASALEREGAAAHNPLLQHMVLLEQSAAQNPLVTGLGALPLQSPSIHKLRQH
RPLGRTQSAPLPQSAQALQQLVVQQQHQQFLEKHKQQFQQQQLHISKMMAKPSEPGRQHE
SHPEETEEELREHQALSESEAMPRGVTIKQEPLEDSEEEQVLQRERQVEQELLFRQQALL
LEQQRIHQLRNYQASMEAAGLSVSFAAHRPLSRAQSSPASASFPMAVQEPTSKPRFTTGL
VYDTLMQKHQCMCGNTNTHPEHAGRIQSIWSRLQETGLRSKCESIRGRKATLEELQTVHS
EAHVLLYGTNPLRQKLDSSVTPMFVRLPCGGIGVDSDTIWNEVHSSGAARLAVGCVVELV
FKVASGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLSVSKILIVDWDVH
HGNGTQQAFYSDPNVLYLSLHRYDDGNFFPGSGGPEEVGSGPGMGFNVNVAFTGGLEPPM
GDAEYLAAFRTVVMPIANEFAPDVVLVSAGFDAVEGHPPPLGGYKLTAKCFGYLTKQLMG
LAGGRVVLALEGGHDLTAICDASEACVSALLGNELEPLPKEVLQQRPNLNAVRSLEKVLE
VQSKYWPSVQRHASTLGYSLIEAQKCETEEAETVTAMASLSMAAKQMENRPEEEPMEEEP
PM
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggactatatttgagaccgagtgctctctctctcctgcagatgggcttcccggc
aaggagcaggccctggaacttctgaagccatctggactcaaccacattccttctgtggat
gtgagtgcagccctgccgttgcaagtgcccccggccgccatccccatggacctgcgcgtg
gagcagcagtttgccctggcccctggcgtgaccccgagcgaccccgtgcgccgcgagcag
cagctgcagcaggagctgctggcactccagcaaaagcaggagatccagcggcagcggcgc
accgcccnnnnnnnnnncgccgagttccagcggcagcacgagcaactgtctcgccaacat
gaagcccagctgcaggagcacatcaagcaacaacaggacctgctggccttaaagcaccaa
caagaactgctggagcaccagcgcaagatggagaagcatcggcaggaacaggagctcgag
aaacagcaccgtgagaaaaagctacagctgctcaagaacaaggagcgtggccaagaaagt
gcagtggccagcacggaggtaaagatgcgtctccaggaatttgtcctgaacaagaagaag
gccttggcccagagaaacctgaaccactgcgtgcccggagacccccgcttctggtacggg
aaaacccagcacagctccttggaccagagctccccaccacagacagggatgtcagccaca
tacaatcaccctgtcctggggatgtatgacccgaaggatgacttccccctccgtaagaca
gcctccgaaccgaatctgaagctgcggtcccgactaaaacagaaggtgactgagcggcgc
agcagtccactgctccgtcggaaggatgttccagtcaacactgccaagaagcgctcactg
gacatggctgtctcacgggaggggttcctgaacatctgctttgcagagtctgcatgtagc
agcgctcctggttccggaccaagctctccaaacaacagctccagcaacattaccaacgag
aacggaatcgccagctccatctccggcagcacagccgagccatccctggtccagcggctg
gccagccgggaaggccctgcaagccagctgtctctgtacacatcaccctccctgcccaac
atcactctgggcctgcctgccaccggaccctccagtgtggcatctggccagcaagacggt
gaccgattggcaatgcccagtctccagcaagggctgcccctgaccactcccttcatccca
gggtcccacttgccctcatacctcagcgcctcagcactggagcgagaaggagctgcagca
cacaaccccctcctgcagcacatggtccttctggagcagtcagctgcgcagaatcccctg
gtcacaggcctgggggctctccccctacagtcgccctccatccataagctgaggcagcac
cggccactgggccgcacacagtcggcccccttgccccagagcgcacaggccctgcagcag
ctggttgtccagcagcagcaccagcagttcctggagaagcacaagcaacaattccagcag
cagcagctgcacatcagcaagatgatggccaagcctagcgagcctggccgacagcacgag
agccacccggaggagacagaggaagagctgcgtgagcaccaggccctgtctgagtcagag
gcgatgccacggggggtcaccattaagcaggagcccctggaagactcagaggaggagcag
gtgttgcaaagggaaaggcaggtggagcaggagctcctcttcagacagcaggccctgctt
ctggagcagcagcgcatccaccagctgaggaactaccaagcatccatggaggcggcgggg
ctgtcagtgagcttcgcagcacaccggcccctctcccgagcccagtcctccccagcctcc
gcctcctttcccatggcggtgcaggagccgacaagcaagccccgcttcacaacaggactt
gtgtacgacacattgatgcagaagcaccagtgcatgtgtggtaacaccaacacgcaccca
gagcacgctggccgcatccagagcatctggtcccgactgcaggagacaggcttgcgcagc
aaatgtgagtccatccgtggaaggaaggccaccctggaagagctgcagacggtccactcg
gaggcccacgtcctgctgtacggcaccaacccactgcgacagaagctggacagttccgtg
acacccatgttcgtgaggctgccctgtggcggaatcggggtggacagcgacaccatctgg
aacgaggtgcactcctcaggagcagcccgcctagctgtgggctgtgtcgttgagctcgtc
ttcaaggtggcgtccggggagctgaagaatggcttcgccgtggtgcggcccccaggacac
catgccgaggagagcacgccgatgggattctgctacttcaactcggtggcgattgcagcc
aagctgctgcagcagaggctcagcgtcagcaagatcctcatcgtggactgggatgttcac
catggaaacggaactcagcaagcattctacagtgacccgaatgtcctctacctgtctctc
catcgttatgatgatggcaacttcttccctggcagcggaggacctgaggaggtgggcagc
gggcctgggatgggcttcaatgtcaatgtggccttcactggaggtctggagcccccaatg
ggagatgccgaatacctggccgctttcaggacggtggtgatgcccattgccaacgagttt
gccccggacgtagtgctggtctctgcgggcttcgatgctgtggagggacacccgcctccg
ctgggaggatataaactgactgccaaatgcttcggctacctgaccaagcagctgatgggc
ctggccgggggccgcgtggtgctcgccctggaggggggtcacgacctcaccgctatttgc
gacgcctccgaagcatgtgtttctgctttgctgggaaacgagctggagccgctccccaag
gaggtgctgcagcagagaccgaacctcaacgcggtgcgctctctggagaaggtcctggag
gtccaaagtaagtactggccatcagtgcagcgccatgcctccacactgggctactccctc
attgaggcccagaagtgcgagacggaggaggccgagaccgtcaccgccatggcttccctg
tccatggctgccaagcagatggagaaccggccagaggaggagcccatggaggaggaaccg
cccatgtag

DBGET integrated database retrieval system