KEGG   Scleropages formosus (Asian bonytongue): 108924741Help
Entry
108924741         CDS       T04919                                 

Definition
(RefSeq) sialidase-4-like
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00511  Other glycan degradation
sfm00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    108924741
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    108924741
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     108924741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR Sortilin-Vps10
Motif
Other DBs
NCBI-GeneID: 108924741
NCBI-ProteinID: XP_018591804
UniProt: A0A1W4YJQ2
LinkDB All DBs
Position
Unknown
AA seq 400 aa AA seqDB search
MGSSLSGRYRTVTECKRTTVFQQFTYRIPSLLRLPEGGDLLAFAEKRATASDTDALWLVM
RRGQVSHDSVQWLPMQELQDATLPGHRAMNPCPVYERDSGTLFLFFICVPTKMSESHQIR
TRKNAARLCYVMSTNQGQNWSAVADLTERVIGEREKYWATFAVGPGHGIQTASGNLIIPA
YAYHIDSWCLRVPCPWTVQPHAFYYYSTDRGKTWLVGHTVHRKSCECEMAEVVDHEGKGH
MYCNARNRGFRRVEALAETDSTGFGKSGLAPKLVEQHHGCQGSVIGFPAPKPYLEKHSKE
STKPTDSLTWLLFSHPTDRRRRRNLGVYLNKRPLQGSNWEEPWIINRGPSGYSDLVYCED
KELFVCLMECGEKSEVEQIASMCFSLSDVLETTGKKAEIQ
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcagcctctccggcagataccgtacggtgacggagtgcaagcgcacaaccgtc
ttccagcagttcacctaccgcatcccgtcactcctccgcctgccggaagggggcgacctg
ctggccttcgccgagaagagggccaccgcgagcgacacggacgccctgtggctggtgatg
agacggggacaagtgtcccacgactccgtccagtggttgccaatgcaggagctgcaggat
gccaccctgccaggtcaccgtgccatgaacccctgcccggtgtacgagagggactccgga
actctcttccttttcttcatctgtgttccaaccaaaatgtccgagagccaccaaatccgg
acgaggaaaaacgcagcaaggctctgctacgtgatgagcaccaaccagggccagaactgg
agcgctgtcgcagacttgacggagcgtgtgatcggagaacgggaaaagtattgggccacg
ttcgctgttggaccgggacacggcatccagacggcgagcggaaatctgatcattcctgcc
tacgcctaccacatcgactcctggtgcttacgtgttccgtgcccatggaccgtgcagcct
cacgccttctactactacagcaccgaccgtggtaaaacgtggctcgttggacacactgtt
cacagaaagtcatgcgagtgtgagatggctgaggtggtggaccacgagggcaaaggacac
atgtactgcaatgcccgaaacagaggctttcgcagggtggaggctctggctgagaccgac
agcacgggttttggaaaatctggcttggccccgaagctggtggagcagcaccacggctgt
caaggcagcgtcataggatttccagcacccaagccctacctggagaagcacagcaaggag
agcacaaagcccacggactcactcacatggctgctgttctctcaccccactgaccggagg
aggcggaggaacctgggcgtgtacctgaacaagaggccactgcaagggtccaactgggag
gagccttggatcatcaaccgcggccccagcggctactcggacctggtgtactgcgaggac
aaggagctgttcgtctgcttgatggagtgcggtgagaagagcgaagtcgagcagatcgct
tccatgtgtttctccctcagtgacgtcttggagacgactgggaagaaagctgagattcag
tga

DBGET integrated database retrieval system