KEGG   Scleropages formosus (Asian bonytongue): 108924799
Entry
108924799         CDS       T04919                                 

Gene name
pold3
Definition
(RefSeq) DNA polymerase delta subunit 3 isoform X1
  KO
K03504  DNA polymerase delta subunit 3
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03030  DNA replication
sfm03410  Base excision repair
sfm03420  Nucleotide excision repair
sfm03430  Mismatch repair
sfm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108924799 (pold3)
   03410 Base excision repair
    108924799 (pold3)
   03420 Nucleotide excision repair
    108924799 (pold3)
   03430 Mismatch repair
    108924799 (pold3)
   03440 Homologous recombination
    108924799 (pold3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sfm01009]
    108924799 (pold3)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108924799 (pold3)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108924799 (pold3)
Protein phosphatases and associated proteins [BR:sfm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108924799 (pold3)
DNA replication proteins [BR:sfm03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    108924799 (pold3)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      108924799 (pold3)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     108924799 (pold3)
SSDB
Motif
Pfam: CDC27
Other DBs
NCBI-GeneID: 108924799
NCBI-ProteinID: XP_018591880
LinkDB
Position
3
AA seq 458 aa
MDDLYLENIDEFINDHNRIVTYKWLSLTLGVHVNQAKQMLYHYLDHKRKESSASQLHATY
LVSGKFVENGNTSHKVAVVREDQLEDVKSKMVLTVSVHVYSVQKAALKDSGPLYSTDYDA
VKENLKNCCKYSAIRCACAAPVSSADEQWGQETTADPLPEPETRNPILNGSSPPAPSKAT
AKQPKGIMGMFNSKSATRTQDSGREVKTEQKEKTTAQETSKTKVAAKASAISNFFGKSAA
TGSSKENSEKVIKEEIVVQTMRVSEEKSLGSHKAEVDVKEEEHKGSHTAGRKCKDGRSKV
KRIEESDSEDEQFESQKKKRRRIKKPQPDSSDDEVIADSSPSHNVDTRTPSPENKVKKEP
VSRAEEKTEGKRRKRRKVLKARTFVDEEGCMVTEKVYQSESFSDSDSDSRSGPQPTEQSG
VQATLRKKEDEHRGQKRSPVPSGKATKQPSIMGFFQKK
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggacgacctttatttagagaacatcgacgaattcataaacgatcacaacaggattgtc
acgtacaagtggttgagtctcacactcggagtccatgtgaaccaggcgaaacaaatgctc
taccactacctggaccacaagcgcaaggagagctctgcgtctcagcttcatgccacctac
ctggtgtccgggaagtttgtggagaatggcaacacgagtcacaaggtggcggtagtgaga
gaagatcagctggaagatgtcaagtcgaagatggtgctcactgtgagcgtacatgtgtac
agcgtgcagaaggcggcgctcaaggacagcgggcccctctacagcaccgattacgatgct
gtcaaagagaatctgaagaattgctgcaagtacagtgccatccgatgcgcctgcgcggca
ccggtatcctccgcggacgagcagtggggacaggagacgacagcggaccccttaccagaa
cccgaaacacggaaccctatcctgaatggaagctctcctccagctccctctaaagccaca
gcaaagcagcccaaggggatcatgggaatgttcaacagcaagagcgcaaccaggacccag
gactcgggcagggaagttaaaactgaacagaaagagaaaaccactgcgcaggagacatca
aaaaccaaggtcgccgccaaggccagtgccatcagtaactttttcgggaagtcggcagca
acaggaagctccaaggagaactcggagaaggtcatcaaggaagagatcgtggtgcagaca
atgcgtgtgtcggaggagaagtctctggggtcccataaagcggaagtggacgtcaaggag
gaggagcacaagggctcgcataccgcgggcaggaaatgcaaagacggacggagtaaggtg
aagcgcattgaagagtctgacagcgaagatgagcagtttgagagtcagaagaaaaaaagg
cggcgaattaagaagccgcagcctgacagcagcgacgacgaagtcattgcagactcttct
ccatcacacaatgtggacacgcggacacctagtcctgaaaacaaagtgaagaaggagcct
gtttcacgcgctgaggagaaaactgaaggcaagaggaggaagaggaggaaagttctgaag
gctcgtacatttgtagacgaggagggctgcatggtgaccgagaaggtgtaccagagcgag
tcgttctcggacagcgacagcgactcgaggagcggcccacagcccacggagcagagcggc
gttcaggccactctccggaagaaggaggatgagcacaggggccaaaaaaggagcccggtc
ccctccggcaaagccacgaagcagccgtccatcatgggattcttccagaagaaatga

KEGG   Scleropages formosus (Asian bonytongue): 108925891
Entry
108925891         CDS       T04919                                 

Gene name
pold4
Definition
(RefSeq) DNA polymerase delta subunit 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03030  DNA replication
sfm03410  Base excision repair
sfm03420  Nucleotide excision repair
sfm03430  Mismatch repair
sfm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108925891 (pold4)
   03410 Base excision repair
    108925891 (pold4)
   03420 Nucleotide excision repair
    108925891 (pold4)
   03430 Mismatch repair
    108925891 (pold4)
   03440 Homologous recombination
    108925891 (pold4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108925891 (pold4)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108925891 (pold4)
DNA replication proteins [BR:sfm03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    108925891 (pold4)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      108925891 (pold4)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     108925891 (pold4)
SSDB
Motif
Pfam: DNA_pol_delta_4
Other DBs
NCBI-GeneID: 108925891
NCBI-ProteinID: XP_029114879
LinkDB
Position
16
AA seq 112 aa
MSPKRRLITDSFKVVKRARAEQRVEKKEEEPPEPPEPEPESRSLTPREKDLQELRKFDLD
WRFGPCTGIGRLQRWDRASHHGLDPPREVRELLLKKSADPEYTHCLWHELPL
NT seq 339 nt   +upstreamnt  +downstreamnt
atgtctcctaagcgcagactcatcacggactctttcaaagtggtgaaaagagcgcgcgca
gagcagagagtggagaagaaggaggaggagccgccggagccgccggagccagagcccgag
tcccgctccctcactccccgcgagaaggacctgcaggaactcaggaagttcgacttggac
tggcgctttggaccctgcaccggaatcggccgtctccagcgctgggacagggcctcccac
cacggcttggacccccccagggaggtgcgagagctgctgctgaagaagagtgcagatcca
gagtacacacattgtctgtggcacgaactcccgttgtga

KEGG   Scleropages formosus (Asian bonytongue): 108940334
Entry
108940334         CDS       T04919                                 

Gene name
pold2
Definition
(RefSeq) DNA polymerase delta subunit 2
  KO
K02328  DNA polymerase delta subunit 2
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03030  DNA replication
sfm03410  Base excision repair
sfm03420  Nucleotide excision repair
sfm03430  Mismatch repair
sfm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108940334 (pold2)
   03410 Base excision repair
    108940334 (pold2)
   03420 Nucleotide excision repair
    108940334 (pold2)
   03430 Mismatch repair
    108940334 (pold2)
   03440 Homologous recombination
    108940334 (pold2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108940334 (pold2)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108940334 (pold2)
DNA replication proteins [BR:sfm03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    108940334 (pold2)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      108940334 (pold2)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     108940334 (pold2)
SSDB
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Other DBs
NCBI-GeneID: 108940334
NCBI-ProteinID: XP_018617923
LinkDB
Position
12
AA seq 501 aa
MSEKSTNIKIRKQIASALNFFSPDNLGPTIMFSDPATRTDGMLLAPPSSGGAGGPVFDRV
QPSYSSQSECFRVGERSFSRQYAHMYATRLMEMRDILTSKAKQTWGADVKVRRLCDLQNG
EQCCIVGTVFKHMELQPSILKEISEEHNLLPQPPRAKYISQSDELILEDELQRIRLEGNI
DTAKFVTGSVIAVLGVEKNDGKFTVEAFCTGDLPPQSPRSRLSSDRFVLLASGLGLGSSG
GDSLLGLQLLVDMVSGQLGDQGEQSRAACISRVLLAGNMLSHSTQDKDSLSKAKYLTKKT
QAGSVEAIRMLDELLVQLVASVPVDVMPGQYDPTNYTLPQQPLHRCMFPLSTAYPTLQLV
TNPYQADIDGVRFLGTSGQNVSDMVKYSSMDDHLEVMESTLRLRHLAPTAPDTLGCYPFY
QNDPFILQECPYVYFSGNAPTYQAKKITGEDGQEVLLVTVPEFSSTQTACLVNLRSLECE
PIVFSSFCPEDEEESEMNISH
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgtcggagaaatctacaaatattaaaattagaaagcaaattgcatcggcgctgaatttc
ttttcaccagacaacctcggccccaccatcatgttttctgacccagcaactcggacagat
ggaatgctcctggccccgccgagctcggggggcgctgggggcccggtgttcgatagggtc
cagccctcctacagcagccaatctgagtgcttcagggttggagagcgcagcttcagccgc
caatatgcgcacatgtacgccacaaggctgatggagatgagggacatcctcaccagcaaa
gccaagcagacatggggagctgatgtgaaagtgagacgactatgtgatcttcagaatggg
gaacagtgttgcattgtgggaaccgtcttcaaacacatggagcttcagccatccatcctg
aaagagatcagtgaggagcataacctgctgccccagccaccacgtgcaaagtacatcagc
caatctgatgaactcattctagaagacgagttgcagagaatcagactggagggcaacatt
gacacggccaagtttgtcacagggagtgttattgcagtgcttggagttgagaagaacgat
ggaaagttcaccgtggaggctttctgtacaggcgatctgcccccacagtcccctagatct
cgcctaagctctgaccggttcgtactcctagcttcagggctgggcctgggcagcagtggc
ggggacagccttttgggcctgcagctgctagtggacatggtgtcggggcagctgggtgat
cagggtgagcagagcagggcagcttgcatctctcgtgtgctgctagccggtaacatgctg
agccacagcacccaggacaaggactctcttagcaaggccaaatacctgacaaagaagaca
caagcaggcagcgtggaagccattcgtatgctggatgagttgctggtgcagctggtggcc
tccgtgccagtggatgtaatgcctggacagtatgaccccaccaactacacgctcccgcag
cagcccctccaccgctgcatgtttcccctgtccacagcctaccccacattgcagcttgtc
accaacccctaccaggctgacatcgatggagtccggtttctggggacttctggtcagaac
gtgagtgatatggtgaagtacagcagcatggatgaccacctcgaggtgatggagagcacg
ctacgcctccgtcacctggcgcccacagccccagacaccctgggctgctacccattctac
cagaatgaccccttcattctgcaggagtgcccatatgtttatttcagcggaaacgcgccc
acctaccaggccaagaagattactggtgaggatggtcaggaggttctcctggtcacagtc
ccagaattcagcagcacgcagacagcctgtctggttaacctgcgaagtctggagtgtgag
cccatcgttttctcctcattctgtcctgaggacgaggaggagagtgagatgaacataagc
cactga

KEGG   Scleropages formosus (Asian bonytongue): 108941735
Entry
108941735         CDS       T04919                                 

Gene name
pold1
Definition
(RefSeq) DNA polymerase delta catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03030  DNA replication
sfm03410  Base excision repair
sfm03420  Nucleotide excision repair
sfm03430  Mismatch repair
sfm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108941735 (pold1)
   03410 Base excision repair
    108941735 (pold1)
   03420 Nucleotide excision repair
    108941735 (pold1)
   03430 Mismatch repair
    108941735 (pold1)
   03440 Homologous recombination
    108941735 (pold1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108941735 (pold1)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108941735 (pold1)
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     108941735 (pold1)
DNA replication proteins [BR:sfm03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    108941735 (pold1)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      108941735 (pold1)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     108941735 (pold1)
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2 DNA_pol_B_exo2
Other DBs
NCBI-GeneID: 108941735
NCBI-ProteinID: XP_018620048
UniProt: A0A0P7US81
LinkDB
Position
8
AA seq 1105 aa
MEGKRVNGSPVTGGASQAKRSKVSGDWEDGPSLFEEELAMLDEAEMEAELREGQAGHDVI
PVGDLFSADLNPRWRRPQPPLLDSTADKLVFQQIEIDYYLGSPVDGMPGQNQGSVPIIRM
FGVTDNGNSVCCHVHGFAPYFYTPAPSGFSPAHLSDFQKELNAVVLKDMRSNKDSVSVTV
LAVDIKRKESMYGFHGNRSVDFLRITMAKPRLIAPAKRLLEQGFKFGSFPLQSYTSYEAN
IDFEIRFMVDSNMVGCSWIELPAGKYRVREEKGLADPELGHPTKVSLCQYEVDVAWTHLV
SHPAEGDWQRIAPLRVLSFDIECAGRKGIFPEPDTDPVIQIASMVQRHGEKEPFVRTVFT
LQSCAPIVGSQLLCFTQERQLLQSWAEFVRTVDPDIITGYNIQNFDLPYLLNRAAALKVD
LFAYLGRVRGIRCVIRDSSFQSKQVGRRENKTVNMEGRVQFDLLQVLLRDYKLRSYTLNA
VSFHFLHEQKEDVQHSIITDLQNGNEQTRRRLAVYCLKDAYLPLRLLQKLMCIINYMEMA
RVTGVPLTYLLSRGQQIKVVSQLLRQAMRQGLVMPVVKTEGGEDYTGATVIEPEKGYYSV
PIATLDFSSLYPSIMMAHNLCYTTLLQKGSMEKLGLSSEDFIKTPTGDLFVKSSVRKGLL
PEILENLLSARKRAKAELKKETDPFKKQVLDGRQLALKISANSVYGFTGAQVGKLPCLEI
SQSVTGFGRQMIEQTKQLVEARYTVANGYQANAKVIYGDTDSVMAKLGVATVKDAMDLGR
EAADWVSTHFTPPIKLEFEKVYYPYLLINKKRYAGLYFSSNSETHDKMDCKGIETVRRDN
CPLVANLINTCLQKILIDRDPQGAVEHAKEVISDLLCNRIDISQLVITKELTRSAQEYAG
KQAHVELAERMRKRDAGSAPNLGDRVPYVIVKAAKGTAAYMKSEDPIFVLENNIPIDTQY
YLEQQLSKPLLRIFEPILGESKAESVLLKGDHTRCKTVLTSKVGGLMAFAQKRSTCIGCR
AVLKTDAAVCDFCKKRQSELYQKEISHLSSLEERFSRLWTQCQRCQGSLHEDVLCTSRDC
PIFYMRKKVQKDLDDQEKLVARFGW
NT seq 3318 nt   +upstreamnt  +downstreamnt
atggaggggaagcgcgtgaacggcagcccggtgacaggtggagcctctcaggccaagcgg
agcaaagtgagcggggactgggaagacggtccctctctctttgaggaggagctggccatg
ctggacgaagccgagatggaggcggagttgagggagggacaagccggccacgatgtcatt
cctgtcggtgacctgttctcggcagacctgaacccccgctggcgccgtccgcagcccccg
ctcctggactccacggccgacaagctggtcttccagcagatagagatcgactactatctg
ggctcccctgtggatggaatgccgggccagaaccagggcagcgttcccatcatccgcatg
tttggcgtgaccgacaacgggaactccgtgtgctgccacgtgcatggtttcgcgccatac
ttctacacacctgcgccgagcggcttctctccagcacacctcagtgacttccagaaggag
ctgaacgccgttgtactgaaggacatgcgctccaacaaggacagcgtgtccgtcactgtg
ctcgccgtcgacatcaagcgcaaagagagcatgtatggcttccatggcaaccggtccgtg
gacttccttcgcatcaccatggcaaaaccccgcctcattgcccctgccaagaggttgctg
gagcaaggcttcaagttcggctcctttccgctgcagagctacacttcgtacgaagccaac
attgactttgagatcagattcatggtggacagcaacatggtgggctgctcctggatagag
cttcctgccgggaagtatcgggtgagggaggagaagggcttggccgatcctgagctgggc
catcccaccaaggtgtcgctgtgtcaatacgaggtggacgtggcgtggacacacctggtg
agccacccggcagagggagactggcagcgtatcgcccctctgcgggtactcagctttgac
atcgaatgcgccgggaggaaaggcatcttcccggaacctgacacggaccccgtgatccag
attgcgtccatggtgcagcggcatggggaaaaggagccctttgtgcgcacagtgtttacg
ctgcaatcgtgcgcccccattgtgggctcccagctgctgtgcttcacgcaggagcggcag
ctgctgcagagctgggcggaatttgtgcgcacggtcgaccccgacatcatcacgggctac
aacatccagaacttcgacttgccctacctgctgaaccgtgccgcagctctgaaggtggac
ctgtttgcgtacctgggccgtgttcgaggaatcaggtgcgtcatccgagactcgagcttc
cagtccaagcaggtgggccgcagggagaacaagacggtgaacatggagggccgagtgcaa
tttgacctgctgcaggtgctgctcagagactacaagctgcgctcgtacacactcaatgct
gtcagcttccacttcctgcatgagcagaaggaggatgtgcagcactccatcatcacggac
ctgcagaacgggaacgagcagacgcgccgccgcctcgctgtctactgcctcaaggatgcc
tatctgccgctgcggctgctgcagaagctcatgtgcatcattaactacatggagatggca
cgggtgacgggcgtgccactcacctacctgctgtcacgtggccagcagatcaaggtggtc
tctcagctcctgcgccaggccatgcgtcagggcctcgtgatgccggtggtgaagacggag
ggaggcgaggactacaccggagccacagtcattgagccagagaaagggtactatagtgtt
cccatagcaacgctggacttctcttcactgtacccgtccatcatgatggcgcataatctg
tgctacacaacactgctgcagaagggctctatggagaaactggggctgtcctcggaggac
ttcatcaagacccccacgggggacctgtttgtgaaaagctcagtgagaaaggggctgctg
cccgagatcctggagaacctgctgtctgccaggaagagggcaaaggctgagctcaagaag
gagacggacccctttaagaagcaggtgttggacggccgccagctggccctcaagatcagc
gccaactccgtgtacggtttcacaggtgcccaggtgggcaagctcccctgcctggagatc
tctcagagcgtcacaggcttcggcagacagatgatcgaacaaaccaagcagctggtggag
gccaggtacacggttgccaacggttaccaggctaatgccaaggtgatctacggggacacc
gactctgtgatggccaagctgggcgttgccaccgtgaaggacgccatggacctggggcgt
gaggcggccgactgggtctcgacccacttcacccctcccatcaaactagagtttgagaag
gtgtactacccgtacctgctgatcaacaagaagcgctacgctggcctgtatttctcctcg
aactcagaaacgcatgacaaaatggactgtaaaggcatcgagacagtacgcagggacaac
tgccccctggtggccaaccttatcaacacctgcctgcagaaaattcttatcgacagggac
ccccaaggggctgtggagcatgccaaggaggtcatctcagacctgctgtgcaaccgcatc
gacatctcgcagctggtgatcacgaaggaactgacgaggagcgcccaggagtacgctggc
aagcaggcacacgtcgaactggctgagaggatgaggaaacgcgacgcaggaagcgccccg
aacctcggcgacagggtgccctacgttatcgtcaaggcagccaaaggcacagcggcgtac
atgaagtcagaggaccccatcttcgtgctggagaataacatccccatcgacacacagtac
tacttggagcagcagctctccaagcccctgctgcgcatcttcgaacccatcctgggggag
agcaaagccgagagcgtcttgctcaagggagaccacacccgttgcaagactgtgctcact
tctaaggtgggtggtctcatggcgtttgcccagaagaggagcacctgcatcggctgccga
gccgtgctgaagacggacgcggccgtgtgtgacttctgcaagaagcggcaatctgaactc
taccagaaggagatctcccacctgagctccttggaggagcgcttctcacgcctctggacg
cagtgccagcgctgccagggctcgctgcatgaggatgtgctgtgtactagccgcgactgt
cctatattctacatgaggaagaaggtgcagaaggatctggacgaccaggagaagctggtg
gcacggtttgggtggtga

DBGET integrated database retrieval system