KEGG   Scleropages formosus (Asian bonytongue): 108925501Help
Entry
108925501         CDS       T04919                                 

Gene name
pola2
Definition
(RefSeq) DNA polymerase alpha subunit B
  KO
K02321  DNA polymerase alpha subunit B
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03030  DNA replication
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108925501 (pola2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108925501 (pola2)
DNA replication proteins [BR:sfm03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    108925501 (pola2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_E_B Pol_alpha_B_N
Motif
Other DBs
NCBI-GeneID: 108925501
NCBI-ProteinID: XP_018593008
LinkDB All DBs
Position
13
AA seq 603 aa AA seqDB search
MTAVSVEDIRAGLAVFDDLCEDDQVLDRMLEQCICHQMDCDDLINEWVAFSTTKGGLKLT
LDILEQFEHEVLNRRKHSKQSFLKKEELQNRMRDVNSLQDLIKAEEEEEILLDSYSTPAK
GSQKRALTTPEHPQSKRSTSSMLSPRLLLSPASFSAGLTPSQKYSSRGARGEVVSTFGTV
QGTRWVGKKGKNAIRVELLEGQDQSLGSSYKFMFQRLRDIRNVLIEKIEELGEELRSHFK
IEEFSPVTLPAQDPITVLGQVCCDSNGKLNAQSVLLEAGQDQGGKRVPLDLSELKEYSLF
PGQVVIMEGMNTTGNRLVPSKLYEGVPLPFYSADDQDTAEDPEPVMVMVACGPYTPSDSL
NYDPLLDLIGVITRDHPDVCILLGPFVDSKHEQIEKCQLTESYEALFLRCVDSIIQGTRG
VGCHLVFVPSQRDVHHHFVYPQPPFIMPGLSKEDKERVSLVSDPSTLLIGGVTFGLTSTD
IFFHMGAEEISSLTSSDRFTRIVKHMLTQRSYYPLYPPAEEINLDYERFQIHGQMLVTPD
VLIVPSELRYFIKDVIGCVCINPGRLTKGQVGGTYGRLLIQRSPPSADGKRQSPCIASQV
VKI
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgacagcggtcagtgtggaggatatccgtgcggggctcgccgtgttcgatgatctctgt
gaagatgaccaggtcctggacagaatgctggaacagtgtatttgccatcagatggattgt
gatgatcttattaatgagtgggtggccttcagcaccaccaagggaggactgaagctcacc
ctggacatcttggagcaatttgaacatgaggtgcttaacagaagaaaacactccaaacag
agctttttaaagaaggaggagttgcagaacagaatgagagatgtgaattctcttcaggac
ctaatcaaagctgaggaagaggaggaaatccttttggactcatattccaccccagctaag
ggttctcagaagcgggccctcacaacaccagaacatccacagtccaaaaggagtacgtca
tcaatgctcagtccccgtctgctcctctctcctgccagtttctctgctggtttgaccccc
tctcagaagtacagctcacgtggtgctcgtggggaggtggtgtctacatttgggacagtc
cagggcacccgctgggtgggcaaaaaaggcaaaaatgcgattagggtggagttgctggaa
gggcaggaccagtcacttgggagcagttataagttcatgtttcagaggcttcgcgacatc
cgcaatgttctgatagaaaagattgaagaacttggagaggaactgaggtctcacttcaag
attgaggagttctcacctgtcactctgcctgcccaggaccccattactgtcctcggtcaa
gtttgctgcgacagcaatgggaagctcaatgcccagtctgtgctcctagaggcaggtcag
gaccaggggggaaagcgggttcccctggacctctcagagctaaaggagtactcgctcttc
ccaggacaggttgtcattatggaggggatgaacacgacaggaaatagactggtgccttct
aagctgtatgagggagtgcctttaccgttttactctgcagatgaccaggacacagcagaa
gaccctgaacctgtaatggtgatggttgcatgtggtccgtacacgccctccgacagcctg
aactacgaccccctgctagaccttattggtgtcattactcgggaccatccggatgtctgc
atactgcttggcccttttgttgattcaaagcatgaacaaattgagaagtgccagctgact
gagtcatatgaagcattgttcttaagatgtgtggatagtatcatacaaggaactagaggg
gtgggatgccacttggtattcgttccttctcagagagatgtccaccatcactttgtttac
cctcagccaccattcataatgcctggactcagcaaggaggataaggagcgtgtgtctctg
gtgtctgatccctcaacgctgctcattggtggtgtgacatttggcttgacctcaacagac
atctttttccacatgggagcggaggagatcagcagtttaacaagctctgaccggttcaca
cgcattgtgaagcacatgctgacccaaagaagttattaccctctttaccccccggcagaa
gagatcaacctggactatgagaggtttcagatccatggacagatgctagtgaccccagat
gtgctcatagtgccatctgagctgcgctatttcatcaaggatgtgattggatgtgtgtgt
atcaaccctggccggctgactaaggggcaggtgggtgggacttatggaagattgctcatc
cagaggagccctccatctgctgatgggaagagacagagtccctgtatagccagtcaggta
gtgaagatctga

DBGET integrated database retrieval system