KEGG   Scleropages formosus (Asian bonytongue): 108925634
Entry
108925634         CDS       T04919                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
sfm  Scleropages formosus (Asian bonytongue)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 ExbD C1_2
Other DBs
NCBI-GeneID: 108925634
NCBI-ProteinID: XP_018593271
LinkDB
Position
2
AA seq 364 aa
MSRGELIELQELTLDDRIELDVPSAPRTPRLERVNALRISPGKVPELLNRVRIIRLLGDN
ADPHLTNESGEGHDFQPCTHAQPTWCDLCGDFIWGLYKQSLRCTNCKFTCHYRCRALIQL
DCSSHRSPFPDQADLAEDTIETDTNVDEQIEWGKQELSISEIEQKVKEYNAQINSNLFMA
LNKDGSYTGFIKVQFKLVRPVSVPPPRKSTATQDGGRRATGMKRRTSFYLPKDTAKHLHI
SSRTRAREVIEALLNKFTVVDNPHKFALFERSERHGQVYLRKLADDERPLQLRLCAGPSE
KVLSLVLKENETGEVNWDAFSMPELQNFLRILQREEEEHIKQIVQRYARAREKMTEALAG
STPG
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtctcggggtgagctcatcgagctccaggagctgacgctggatgaccgcatcgagctg
gacgtcccgtcagcccctcgcacgccccgcctggagcgcgtcaacgctctgcgcatcagc
ccggggaaggttccggagctgctcaaccgggtccgcatcatccggctgctgggggacaac
gcggacccccatctgaccaacgagtccggggagggccacgacttccagccgtgcacgcac
gcccagcccacctggtgtgacctgtgtggagacttcatctggggcttgtacaaacagagt
ctacgatgcaccaactgcaagttcacttgccactaccgctgcagagcactaatccagtta
gactgcagttcccatcgcagcccctttcccgaccaggcggaccttgcagaggacaccata
gagacagacaccaatgtggatgagcagattgagtggggaaagcaggagctgtctatcagt
gagattgaacaaaaggtgaaagaatacaatgctcagatcaacagcaatctcttcatggcg
ctgaacaaagatggctcctacactggcttcatcaaggtccagttcaagctggtgcggccc
gtgtcagtcccccctcctcgcaagtcaaccgcaacgcaggatgggggccgacgagccaca
gggatgaaaaggcgcacttccttctaccttcccaaggacacggccaagcacctgcatatc
agctctcgcacacgtgcccgtgaagttattgaggcactgctcaacaagtttacggtcgtg
gacaacccgcacaagttcgccctttttgaacgcagtgaacgtcatggccaggtgtacctg
cggaagctggcagatgatgagcggcccctgcagctgcgtctgtgtgctggacccagtgag
aaggtgctcagcttggtgctcaaggagaatgagactggcgaggtcaattgggatgccttc
tcaatgccagagttgcagaattttttgcgaatcctgcagcgtgaggaggaagaacacatc
aagcagattgtgcagcgctatgcccgtgcaagggagaagatgactgaagccctggccggc
agcacccctggctga

DBGET integrated database retrieval system