KEGG   Scleropages formosus (Asian bonytongue): 108925953
Entry
108925953         CDS       T04919                                 

Gene name
neil3
Definition
(RefSeq) endonuclease 8-like 3 isoform X1
  KO
K10569  endonuclease VIII-like 3
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108925953 (neil3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108925953 (neil3)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     108925953 (neil3)
SSDB
Motif
Pfam: zf-GRF H2TH Fapy_DNA_glyco zf-RanBP zf-FPG_IleRS
Other DBs
NCBI-GeneID: 108925953
NCBI-ProteinID: XP_018593854
LinkDB
Position
3
AA seq 575 aa
MVEGPGCALNGEKIVGRVRTGQEVLQVTGHATRNEGSSFSILTGSRYVGTETLGKELFIY
FGPRALRVHFGMNGSMRINPADQMDGSGKLAALEIRLTNDVICFFDAAVEIRLRDDCEQK
VRNMQTLDICSPKFSFSRAEEAVKKEGARMLCDVLMDQAVLPGVGNIIKNEALFNSGLHP
ALKVSQLTDGQISHLVKMTRDFTLLFYKCRKSGAPLYKHFKVYKQPNCGRCSGKITVCRL
GENGRMTYFCSNCQSGDPSQVNVSKVPRGSGLGGWLSKEASGHRAGAEEEEWACTLCTLV
NGASARSCEACLSPRSEAGIPPATVPKEEAKEDFSSSSRHLIKYPYNAFAKPREAQRVNR
KAVFGTSTLVFTDFSDAAPLASAPLASQSARLNSLASGSMNKQSVSRGESSPKFLAGSSC
KRSSDFSGGESMAPCSQMHKKMRIDHGPFCGNKPQSGSCTFAVTEVKVNKVDTKQLSSPR
SPCCAVHRRPCALRVVRKEGDNKGRQFYACSLPQETRCDFFKWADLYFPTCKHGKRCLMR
TVLKLGPNNGRNFYVCPLGMGRQCDFFQWADTHSI
NT seq 1728 nt   +upstreamnt  +downstreamnt
atggtcgagggtccgggctgcgcgctaaacggggagaagatcgtcggccgcgtgcgaacg
ggacaggaagtgctgcaggtgaccgggcacgcgacacgtaatgagggctcatccttctcc
atcctcacgggttctcgatatgttggcacagagaccctgggaaaggagcttttcatctat
tttggtccaagagctctgagagtccactttgggatgaatgggtccatgaggatcaaccct
gctgaccagatggatgggagcgggaagcttgcagcgctcgagatccgtctcaccaatgat
gtcatctgctttttcgatgcagctgttgaaatcaggctgagagatgattgtgaacaaaaa
gttcggaacatgcagactttggacatttgctcccccaagttcagtttctccagagcagaa
gaggccgtgaagaaggaaggcgcccgcatgctgtgcgacgtcctcatggaccaagcagtc
cttcctggagtgggcaacattatcaaaaatgaagctctgtttaacagtggtctccaccct
gcccttaaggtcagccaactgactgatggtcagatcagccatctggtaaagatgactcgt
gacttcactctacttttttacaagtgtcgaaaatctggagctccgctttataaacatttt
aaagtttataagcagccaaactgcgggcggtgtagtgggaaaatcactgtctgtcgactt
ggagagaacggtaggatgacatatttctgcagcaactgtcaaagtggggacccgagccag
gttaatgtgagcaaagtgcctcgtgggagcggattgggaggctggctgtccaaagaagcg
tccggccaccgtgcaggcgcagaggaagaggagtgggcctgcacgctctgcactcttgtg
aacggcgccagcgccaggtcctgcgaggcctgtttgtcaccacggagtgaggcagggatt
ccacccgcaactgttcccaaagaggaggcgaaagaggatttttcatcttccagcagacat
ttgataaagtacccatacaacgcctttgccaagccacgagaggcacagagagtcaacagg
aaggccgtctttgggacctcgactctggttttcaccgatttcagtgacgccgcccccctt
gcgagtgccccccttgcttcacagagcgcccgtttgaattctttggcaagcggcagtatg
aataagcaaagtgttagtcgaggggaatcaagtccaaagtttttggctggttcgtcttgc
aagaggagctccgacttctccggtggggaatccatggccccttgcagtcagatgcacaag
aaaatgagaattgatcacgggcctttttgtggtaacaagccacaaagcgggagttgtacc
ttcgcagtcactgaagtaaaagtgaacaaggtggatactaagcagttgtcttctcccaga
agcccttgctgtgcggttcacagacgcccctgtgccttgcgggtggtcaggaaggaggga
gataacaaaggtcggcagttctacgcctgctctctgccacaggaaacgcggtgcgatttc
tttaagtgggctgatttatacttcccaacctgtaaacacgggaaacgatgcctgatgaga
acggttctgaaacttggacctaacaatggacggaacttctacgtttgccctttgggaatg
ggcagacagtgtgacttcttccagtgggctgacactcactcaatttag

DBGET integrated database retrieval system