KEGG   Scleropages formosus (Asian bonytongue): 108926532Help
Entry
108926532         CDS       T04919                                 

Gene name
fanca
Definition
(RefSeq) Fanconi anemia group A protein isoform X1
  KO
K10888  fanconi anemia group A protein
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    108926532 (fanca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108926532 (fanca)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     108926532 (fanca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fanconi_A_N Fanconi_A
Motif
Other DBs
NCBI-GeneID: 108926532
NCBI-ProteinID: XP_018594774
UniProt: A0A1W4YT97
LinkDB All DBs
Position
7
AA seq 1457 aa AA seqDB search
MAEENRIMSMPQTLGGHRRPFSALLAAHIVKKPRYESEAVLHEAAVKLISRHQNLSDLLL
EASRTPSGPTENVGLAQQDVCLGSLTPPETGTWATPLSGPGGSLIVHALQRQAVELGVPV
GEVSAKLVAEKLRGLMGCSEAHGRRLPLNSTQRAELSVLVQSAQELLSHRAFSPSAFCRE
LWKALENPLLEVVWHFHLGRILTVEYILESEEGAESWLVTELRSLCGGTTEEQGQKEDKE
VQKQILTGVVSVLVRAAFQKPQDPGSAQRNISQQCCFVLDDMLSCVLDSLHKTQDQQAGT
VIAECWVQVLDSMSCDVTMSDDVLGCFFTHSLTYILTYRPQFKVSHAIAMQSEWCFAKTS
RLLTALYRKLSILLSMEKLLSHLQQVLETDEVNWQHVLSFLSTLLVYYPQAQRSLIELLS
RLLSSAFEGYDLENMITSFLLARQGALEGPAVFPSYSEWFKMSFGSASGYHGNSKKSIVF
LLKFLSDLVPFDPPQYLKVHILYPPYVPVKHRTLLQEYVSLAKTRLADLKVSVDGMGLYE
DLSGAAAPVQCQAKQDVDKAVSLFESTGKISTAVMEASIFRRPYFLSRFLPVLLTPRALP
AKPDIRMAFIESLRKAEKIPSALYSNYIQACQRERERHRPEERGVVEVSADRQPLERLQD
ELQDLRHLLLTPGAEEVSAQLARISEALTVLVPEGVDEPLRQTIMEFHVDPPTTSDLENK
VINSVLVGFCQIFMDASKINPPNSRQGPWASHFVAMLLGHKKLLMSLLHRLKDLLCNQGA
SLSAAHILGLAVFFVHLHQCRAICPLVLSDSTPCSEALAAALPCSTGADMSFCLRFCVAA
VCYALCRSDSSPDRVHDYVPSSLCKKLLYLVSRLLPGTRTVLEGGGVQSADEGTQEEKEA
GRGMWRNITDPLASWKSSVVALWRQPCFLALQTLPDYQLSFAEWVKAELRVQRSTDILSD
PERQEYQQWVCQQQYLSVPLNQGGCAGDIRQACSHIFHAIMEFYTCTQTVQTTRCGPPEA
DSCLPDIVSRLQELVYELEMNRAFRRDEEDQRSFILDVISEKCSVTSESLAVSSELELQQ
TMHIWSRVVVALPPTVLLSVRSLGDKRRLDLRAFAEHINQRHRNVCVPAGRLPYDITAHF
LKGVLTVSLRCDHPSQAVNKLLSRMHQQCPLLLVSVGVWWSRLCPVLLSLWTRLSGGPLP
ESLQRVADCCAWACSAVKGEVVPPPAVPALLLAACLHHAGKGQRKQCSTRRTLEQLGQLQ
EQHGLFPVFLLFFWVTDLLSTFLQLQKEDAEPAREHCMEILGYLCDTADWLLLFHPPGPE
QGWYNTLAEVTTDGTTRLMPLAFYSLVPKLDTQVLGKMLKVPGFLLTALHSYSALTRLFL
DGQTPLPDSSSEQADPLQILSQAKQFLLRTISLSPQTHFSENSSQLKDACGDLDPEVSSA
VSSRLSQHDFSEEPDFL
NT seq 4374 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggagaatcgaatcatgtctatgccacagactttggggggccacaggaggccc
ttttcagcccttctcgcagcccacattgtgaagaaacccaggtatgagagtgaagcggtg
ttgcacgaggcggctgtcaagctgatcagccgacatcagaacctgtcagacctgctgctg
gaggcgagtcgcacacccagtggccccactgagaatgtggggctggcacagcaagatgta
tgcctggggagtcttacccctcctgagacagggacctgggccactcctctttctggccct
ggaggctcactcatagtgcatgcactgcagaggcaggctgttgagctgggggtcccagtg
ggggaggtgtcagcaaagttggtggcagagaagcttagaggactgatgggatgctctgag
gctcatggccggaggcttccgttgaactccacgcagagagctgagctctctgttctggtc
cagtcagctcaagaactgctctcacacagagcctttagcccttcagccttttgccgtgaa
ctctggaaagctctggagaatcctctgctggaggtggtctggcatttccacttgggaaga
attcttactgtggagtacattttggaaagtgaggagggggctgagtcatggttagtgaca
gagctgagatctctttgtggaggaaccacagaagagcagggacaaaaggaggataaagag
gtgcaaaagcagatcctcacaggtgtggtatcagttctggtgcgggcagcattccagaag
ccccaggacccaggatctgctcagaggaacatctctcagcagtgctgctttgttctcgat
gacatgctctcctgtgtgttggacagtttgcacaagacacaagaccagcaggccggaacc
gtaattgctgagtgctgggttcaggtgttggactcgatgtcctgtgatgtaaccatgtca
gatgatgtgctgggttgcttcttcactcattctctcacatacattcttacctacagacct
cagttcaaagtgtcacatgccattgcgatgcagagtgaatggtgctttgctaaaaccagc
cgattgctgacagctttatatcggaagctctccattctcctcagcatggagaaactgttg
tctcacctgcagcaggtgctggagactgatgaggtcaactggcagcatgtgctctccttc
ctctccaccctgctggtgtactacccacaggcccagcgctcactcatagagctgctttct
cgccttctgagctccgcttttgagggctatgacctggaaaatatgatcacttcattcctg
ctggctcgtcagggggcgcttgagggcccagctgtctttccctcgtatagcgagtggttc
aagatgtcctttggaagtgccagtggttaccatggtaatagcaaaaagtccatagtgttt
ctactgaagttcttgtctgacctggtgccctttgatccaccacagtacttgaaggttcac
atactctacccgccttatgtacctgtgaagcaccgcaccctcctccaggaatatgtgtct
cttgctaagaccagacttgctgatctaaaggtttcagtggatgggatggggctctatgag
gacctatcaggagcagcagctccagtacagtgtcaggcgaaacaagacgtggacaaagct
gtcagtctgtttgagagcacggggaagatttccaccgcagtaatggaggccagcattttc
aggagaccgtacttcctgtcccggttcctccccgtcctcctaaccccacgggcacttcct
gccaagcctgacatccgcatggctttcatcgagtccctcaggaaagcagagaagatcccg
tctgctttgtactctaactatatccaggcgtgtcagagggaaagagaaaggcacaggcca
gaggagagaggagttgtggaggtgtcagcggaccggcagcccttggagagactccaggat
gagcttcaggatctcaggcacctgttgttgacccctggtgctgaagaagtgtcagcacag
ctggctcggatatctgaggctttgactgttctggttcccgagggggttgatgaaccactg
cgccagactatcatggagttccatgtggacccacccaccacctcagacctggagaacaag
gtcatcaactctgtgctcgtaggcttctgtcagatttttatggatgcctcaaaaatcaat
ccaccaaacagcagacaaggcccatgggcctcccattttgtggccatgctgctgggacac
aaaaaactgctcatgtctctactgcaccggctgaaagatcttctttgtaaccagggggcg
tcattgagtgctgcacacatcctgggccttgcagtgttttttgtacacctgcatcagtgc
agagccatatgtcccctggtcctcagtgactccacaccctgctctgaggctctggctgcg
gccctaccttgcagcaccggtgcagatatgagcttctgcctcaggttctgcgtggctgca
gtgtgctacgcactatgccgaagtgattcatcaccagaccgtgtgcatgattacgttccc
agcagcttgtgcaagaagctgctctacctagtctccaggctactgcctgggacaaggaca
gtactggaaggtggaggagtacagtcagcagatgaggggacacaggaggagaaagaggct
ggacgtggcatgtggcgcaacatcacggatcctttggcttcttggaagagctctgttgtg
gcactatggcgacagccttgcttccttgccttacaaacattaccagactaccagctctcg
tttgcagagtgggtaaaggctgagctcagggtgcagaggagcacagatatcctgtctgat
ccagagagacaggagtatcagcagtgggtgtgtcagcagcagtacttatcagtgccatta
aaccaagggggctgcgctggggacattcggcaggcctgcagccacatcttccatgctatc
atggagttctatacctgtactcagacggtgcagacgacccggtgcggaccacccgaagca
gacagctgtctcccggacattgtgtctagactgcaggagctggtgtacgagttggagatg
aaccgtgccttcaggagagatgaggaagatcagaggagtttcatcttggatgtgatttct
gagaagtgttctgtgacctcagagtccctggctgtcagcagtgagctggagctgcagcaa
acaatgcacatctggagcagggtggtagtggcattgcccccaacagtgctgctgtcagtc
aggtctctgggggacaagaggaggctggacttaagggcgtttgcagagcacattaaccag
agacatagaaatgtttgtgttcctgccggccggttgccctacgatatcacagcacacttt
ctcaagggtgtgttgactgtgagtctgcgctgtgatcacccaagtcaggctgtgaacaag
cttctctcccgaatgcaccagcagtgtcctctgcttctggtctccgtaggggtttggtgg
tctcggctgtgtcccgtgttgctgtctctgtggactcgtctgagtggcggaccgctgcca
gaaagcctgcaacgtgtagctgactgctgtgcctgggcctgcagtgcagtgaaaggggag
gtggttccaccccctgcggtcccagcactgctcctggctgcttgtctgcaccatgcaggg
aagggacaaaggaaacagtgtagtaccaggagaaccttggagcaactggggcagctgcag
gagcagcatgggctgttcccagtgttcctgctctttttctgggttacagaccttctgtca
acattcctccagctccagaaagaagatgcagagccagctagggaacactgtatggagatc
ctgggatacctgtgtgacactgcagattggctgctgctgtttcacccacctggtccagag
cagggatggtacaacactttggctgaggttacaacagacgggaccaccagactgatgccc
ctggctttctacagcctcgtacccaaactggacacacaggttttggggaagatgttgaaa
gttccgggattcctcctcacagctctacattcctactctgccctaaccagacttttcctg
gatggccagacccctttacctgattcctcctctgaacaggctgaccccctgcagattctg
agtcaagcaaagcaatttctcctcaggacaatctcgctgagtccacagactcatttttct
gagaacagcagccagttgaaagatgcctgtggggatctagacccagaggtgagctctgct
gtgtcttcacgtctgagccagcatgatttctctgaagagccagacttcctgtga

DBGET integrated database retrieval system