KEGG   Scleropages formosus (Asian bonytongue): 108926870Help
Entry
108926870         CDS       T04919                                 

Definition
(RefSeq) serine/threonine-protein kinase Nek5 isoform X1
  KO
K08857  NIMA (never in mitosis gene a)-related kinase 1/4/5 [EC:2.7.11.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    108926870
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sfm03036]
    108926870
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108926870
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108926870
Protein kinases [BR:sfm01001]
 Serine/threonine kinases: Other
  NEK family
   108926870
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    108926870
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    108926870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like PBC
Motif
Other DBs
NCBI-GeneID: 108926870
NCBI-ProteinID: XP_029114016
LinkDB All DBs
Position
14
AA seq 823 aa AA seqDB search
MDKYGVVRKIGEGAFGEVFLVRAKDDSNNTECVVKEINMRKMSAKEKEASRKEVTLMAKM
KHPNIVTFLMSFEERSTLYIVMEYCSGGDLMKRIRMQRGILFTERQIVDWFVQICLGLKH
IHDRKVLHRDIKAQNIFLTGNGMKAKLGDFGIARMLNNTMEMARTCVGTPYYLSPEICEG
RPYNNKTDIWSLGCVLYELCTLKHPFEGSNLRQLVMKICRGHYHPVAAHYSYELRLLVTQ
LFKVSPRDRPSVNSMLGRPFLEKHIEKHLDAQIIKDEFSHIVSHRKKLQPGQVPEVVPKP
RAREKSAPRTKAGTPMRKEPLRQVWKPAACVAQPEYKNVVYPKAAAMEKLPARICGPNDL
DRSNVHVVGEDEQHRELYQRYHAQLDAIQRRRQEESPPPPHGAGPGKARGHHGDQPNITE
PYQLVAAAREEYLQRRQEARQYKLRAEKQLGLRPSSSHQQRDAEPGQGVPALPRSQCRRP
GPVRKRDDQQEYLTQLRRIREQYHREVQEMRRRAAGEPQDAAREQPLAESPPGPGGGAQS
RRSDGNAAAQRGITFEVLLDEESAPGDREEEGAQDERGQAEEQEREEEEMDPLNRTLTFE
AGEELGLRERPPAEAELEAQRRKRWSKKTPRTLLNALAEMEVSSVCPGTCGSDPGAEDGG
AAGQRRLWRKDPPETLLRALAEATLSSTGTPAPSGTLPPSQPDPDAEDTEEEGGCDVDVD
EERLEPRSDDDDTNFEESEDELREEVAESMRKYFSVDEASGGGAEVPGGPDTDGGPGLVP
EPREREEGAAGPRTAPSSQEVPTSDREAPKAEAAETERTESGL
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatatggggtagttcgcaaaattggagaaggagcgtttggagaagtgttctta
gtgagagcaaaggatgacagcaacaacacggagtgtgtggtgaaagagatcaacatgagg
aagatgtcagcgaaggagaaggaggcctcgcggaaggaagtgactctgatggcaaaaatg
aaacaccccaacatcgtaacatttctgatgtcctttgaggagcggtccactctttatatc
gtgatggagtactgcagtggaggagacttgatgaagaggatcaggatgcagaggggcatc
ctgttcactgagcgtcagatagtggactggtttgtgcagatctgcttgggactgaaacac
atccatgaccgcaaggtcttacacagggacatcaaagcacagaatatattcctcaccggc
aatgggatgaaagcgaagctcggcgacttcggaatcgcaagaatgctgaacaacaccatg
gagatggccaggacgtgcgtgggaaccccctattatctgtctcccgagatctgcgagggg
agaccgtacaacaataagacggacatctggtctttgggttgtgttctctatgagctctgc
accctcaaacacccgtttgagggcagcaatctaaggcagctggtgatgaagatctgcagg
gggcactaccaccccgtcgcggcccactactcctacgaactgcggctcctcgtgacccag
ctgttcaaggtcagcccccgcgaccggccctcggtcaactccatgctcgggagacccttc
ctggagaagcacattgagaaacacctggatgcccagataatcaaagatgagttcagccac
attgtgtctcatagaaagaagctccagccgggacaggttccagaggtggttccaaaacca
agggccagagagaagtctgctcctcgcaccaaagctgggacccccatgaggaaagaaccc
ctcagacaagtgtggaaacctgcagcctgtgtcgcccaaccggagtataaaaatgtagtt
tacccaaaagctgcggcgatggagaagctaccagccaggatctgtggtccgaatgacctc
gaccggtcgaacgttcacgtggtcggcgaggacgagcagcatcgcgagctctaccagcgc
taccacgcccagctcgatgccatccagcgccggcgtcaggaggagagccctcctcccccc
cacggtgcaggtccagggaaggccaggggtcaccatggtgaccagcccaacatcacagaa
ccgtatcagctggtggcggctgctagggaagagtatctgcagaggaggcaggaggccaga
cagtacaaactgagggctgagaagcagctgggcctgcgcccctcctcctcacaccagcag
agagatgcagagccaggacagggggtgccagctctaccacgaagccagtgccgacggccc
ggtccggtcaggaagcgggatgaccagcaggagtacctgacgcagctgcggcgcatccgg
gagcagtaccatcgagaggtgcaggagatgaggaggagggccgcgggggagccccaggac
gcagcgagggagcagcctttggcggagagtcctcctggtcccgggggcggagcccagagc
cggcggagcgacgggaacgcggctgctcagagaggaatcacgttcgaggtcctgctggac
gaggagagcgcgcccggggaccgagaggaggagggcgctcaggacgagagaggacaggcg
gaagagcaggagcgggaggaggaggagatggatccgctgaaccggacgctcaccttcgag
gccggagaggagctcgggctgcgggaacggccccctgcggaggcggagctagaggcgcag
cgcaggaagaggtggagcaagaagacgccccggaccctgctgaacgctctcgctgaaatg
gaggtgtcctccgtctgtcccggcacgtgcggatccgatccgggagcagaggatgggggg
gcagcgggccagaggaggctgtggcgcaaagacccccccgaaaccctcctgcgggccctc
gccgaggcgacgctcagcagcacgggcacccccgccccctcgggaaccctcccgccaagc
cagccggacccggatgccgaggacaccgaggaggagggaggctgcgatgtagatgtggat
gaagagcgactggagccacggtcagatgacgatgacacaaactttgaggaatcggaggac
gagctgagggaagaggtggccgagtccatgaggaagtacttctccgtggacgaggcctcc
ggggggggggcggaggtcccaggcggcccggacaccgatgggggaccggggctcgtcccc
gagccgagggagcgggaagagggggccgcggggccgcgcacggcgccctccagccaggag
gtgccgacctcagaccgcgaggccccaaaggcggaggcggcggagacggagcggactgag
tcgggactgtga

DBGET integrated database retrieval system