KEGG   Scleropages formosus (Asian bonytongue): 108927404Help
Entry
108927404         CDS       T04919                                 

Definition
(RefSeq) steroid 21-hydroxylase
  KO
K00513  steroid 21-monooxygenase [EC:1.14.14.16]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00140  Steroid hormone biosynthesis
sfm01100  Metabolic pathways
Module
sfm_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    108927404
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sfm00199]
    108927404
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     108927404
Cytochrome P450 [BR:sfm00199]
 Cytochrome P450, animal type
  CYP21 family
   108927404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 DUF3512
Motif
Other DBs
NCBI-GeneID: 108927404
NCBI-ProteinID: XP_018596191
LinkDB All DBs
Position
18
AA seq 523 aa AA seqDB search
MCVSAFSVATALLLFLLWILVFYLSRRSCQHLAYKTSSQSRAVQSRRLFSLYRVLTECFS
PSLPGPPSLPLLGNMLDLTRGHLPSHLTSLARCYGSIYRLRCGKTTMVVLSSAQMIREAL
VKKWPDFAGRPHSYTGDLVSGGGFSISLGDYSEEWKMHRRLVHSALQRCCAQSLHAVIER
QALTLRQVILDYKESPVDLSKDFTVAASNVITSLVFGKEYNKSSAELQRLHDCLNEIVSL
WGSPWISALDTLPLLRRFPNPPFSRLLKEVERRDELIRSHLQDCKMQYEDKNADGIITAS
LLQCQDQTGGQSQRTTLTETQVHMAVVDLLIGGTETTAAWLYWMVAFLLHRPEVQFNVYN
ELCTVLDSRYPRYSDRHRLPCTSALISEVLRLRPVAPLAVPHRATRDSSIAGYFIPKDTI
IIPNLYGAHHDPDVWDDPNTFKPERFLEDKGASTRALVPFGGGARLCLGESIAKMELFLF
AAYLLRDFQFLPTGNKTSLPDLKGVASVVLKAKPFHVIVRPRP
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtgtcagcgttcagtgtagctactgcactgctgttgtttcttctctggatattg
gtcttctatttgtccagacggtcatgtcaacatctggcctacaagaccagctctcagtca
agagccgttcagtccagacgcctcttttctctttaccgtgtcctcaccgagtgcttttcc
ccctccctgcctggccccccttcactccctctcctggggaacatgctggacctcacaagg
ggacatctccccagtcacttgacctccttagcccgttgctatggcagcatctaccgtctt
cgctgtggcaaaaccaccatggtggtgctgagcagtgctcagatgatcagggaggctctg
gtgaagaagtggccagactttgctggaaggccacattcatacacaggagatcttgtgtca
ggtgggggcttttcaatctcactgggtgactacagtgaggagtggaaaatgcaccgtcgc
ctggttcacagcgcactgcagcgttgttgtgcacagtccctgcacgctgtcattgagaga
caggccctcacactcagacaggtaatactagactataaggagagccctgtggacctttca
aaggattttacagttgccgccagtaatgttatcacatctctggtcttcggaaaagaatac
aacaagagctctgcggaactgcaacgtctgcatgactgtctcaatgagattgtgtccctg
tggggctcaccgtggatctccgccctggacacccttccgctgctcaggaggtttcccaat
ccacctttttcccgtctactgaaagaggtggaaaggagagatgaactcatcagatcacac
ctccaggactgcaagatgcaatatgaggacaaaaatgctgatggcatcatcacagcttct
cttcttcagtgccaggaccagacagggggccagtcacagaggactactctgacagagacc
caggtgcacatggccgtggtggatctgctgatcggtggcacagaaaccactgcagcctgg
ctctactggatggtggccttcctgctgcacagacctgaggtgcagttcaatgtgtacaat
gagctgtgcacggtgctggacagtcgctaccctcggtacagtgacagacacaggctgcct
tgcacatctgccctcatcagcgaggtgctcagactcaggccggtggctccgctcgcagtt
cctcatcgtgctactagggacagcagcattgcaggttacttcatcccaaaggacaccata
atcatccctaacctgtatggggctcatcatgaccctgatgtctgggatgatccaaacacc
ttcaagccagaacgcttcttggaagacaaaggggcttccacccgagcactcgtgcctttt
ggaggtggtgcaaggttgtgcctgggagagtccattgctaaaatggagctcttcctgttt
gctgcctatctactacgtgactttcagttccttcccactgggaacaagacctctctacca
gaccttaaaggagtagccagtgtggtgctcaaagccaagcctttccatgtcattgtgcgt
ccacggccttga

DBGET integrated database retrieval system