KEGG   Scleropages formosus (Asian bonytongue): 108927425Help
Entry
108927425         CDS       T04919                                 

Gene name
setd2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108927425 (setd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sfm03036]
    108927425 (setd2)
Enzymes [BR:sfm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108927425 (setd2)
Chromosome and associated proteins [BR:sfm03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108927425 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW AWS
Motif
Other DBs
NCBI-GeneID: 108927425
NCBI-ProteinID: XP_018596230
UniProt: A0A1W4Z690
LinkDB All DBs
Position
Unknown
AA seq 2876 aa AA seqDB search
MGDVYDPEHPTEEGGGDTVVKEESLSKPTLLKNLPTKGLLSSRLLPKGTKSKVNLEEHGR
QKVSFSFSQTKKPLPNLFLSQLSPEKSPCDLQLPLLSSNNSQQGKLELKVESRNESTGLS
FPTPVPESPLSVTSLPKSKLELGKMHFKKQLLSVSASFEKPVDEPKPTIKLEEVSSLQET
VLKPATKITTEAAVSQIQLTFKDCISEEHVIGVLEENLNPSVKGSTDSSHIGTEIKEKFS
GLEQADIPEQHKSQSQSDSTLPGSESDGDSVRTSSSHKSGDPRSMAKTDNQNKDAKRNFS
RVEESEKLEKSSSYAKSDERVKEERCSTHSKSDRETRYSRSSRSDKERRRTKSRSRSRSR
GSRTSSSYSRSERSSRNERLSRSDRSHYHDSERRSYRSPYRERRSSRSRSDRKSRDSSDS
EDDYRRARTGSNRSSNHSSSHRDSKFFYSKSEKDVKCSEISRSSETEKRIQLHSRSERCP
RKIEFESIRKTSPELESECRKSNAHCKLESNIKSPLSKSNICSQTIDKKPHKGHSSSDSE
DDQKEKSKFIKLPPCSGLNDSQPAMSEKDFKVSLSKLIVTDAQVQDKLNNTELIQMQSHS
NKYCPSSFEDGTQCQLNCLPSKHIDLSQSKDTAIPSKEMHHLSVPDPVSANDFVGQDCEE
ADSVNVTVSSGATLAPTYSLRSKSKPHKHNSSPPPKLLIVNTDSAQQCRSNQSLNKSSSV
VCDTVLPDSCVSSETFTNEQDKEQLCKYGHTLPVVPVVLRKNETGVLSEPSRNSSPAVLS
CQPYSKDNTSPGLSEESMMCVVSSERLSNLSGIEVLEGANVSSESNAHINDSIEVTNGFP
SNRHVLQGHNSCEGEGHVESSIPVYRESIETKHYATAQLSSYSTCVLPDCSPPQISQKVC
NPAEISIKELSLGDLQQKTKSEDICHGSLDETGSQSSVVPPKFESTKVSELSVASQQSEQ
LNIKTEQQSGTLLKNKINLKKSRWDIVGQDKSDHEHSLKMPCHETKPSVKKIISVKKIEF
SKDSGLEHVKNFGTIKMNLNNETVLSKQHSVGKNHASLEDNSLKSPQNQLDAKTQLSMST
QSQPCDTSNTNVDICFDQNYKEPPRSSHATSRSVAKDWTRDSKTGGHDVLLDKLERRNTS
INQDVGSHSDDSDSEESDSDSDDCSIPKNRLHSVVVVPKNSTLTQPHDSRATLTSFSSPT
GSPHQLPADWQEQGWRGSSSKESNRAHDAYSEVSGTLSPVERQKGFSSQLPESSKHTLHV
LCTERPILTGQQNVTYQSQSNMVDSTSHVEASHTFEAQQSKEQKSSTYQNPKISVPSSSV
GSFHSFETMWRTSDPGQSRPCDRPDSWHDRKSILMHQQHGEFSSSDDLSNKDGYRWGWDI
PQPEQPSSTFQQPDSSYGIHTPNPMLVGSPALGQMGQHSSGCWIQPTASQGCRPVYLSVP
SLYRESLDEMHPDSLTNDYEEESQENHGTVTFCNHPPPASTSFVQGPEISSNCRGLGGVL
DTPREDSQKPHRGRGPPKKRRPEFESDSENEAESENSIKRERLAEPDVSRTSKDPVDTPN
QTAEVERPSLSLQDFQDPVRWKDMAKLKKMPPYFDLIEENMYLTERKKNKSHRDIKRMQC
ECAVLSREERARGATACGEDCLNRLLMIECSSRCLNGSYCSNRRFQMKQHADFEVILTEN
KGWGLRAAKDLAPNTFVLEYCGEVLDHKEFKARVKEYARSKNIHYYFMALKNNEIIDATL
KGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKGVSAGTELTFDYQFQRYGKEAQKCL
CGAPSCRGFLGGENRVSIRAAGGKMKKERSRKKDSVSALTTVDEELEALLENGEGLSDEK
EVISLCRLMVRVETMEQKLTCLKLIQNTQNPGCLKQFLDHHGLSLLWIFMVELSEAKGNS
SNNIKLQLEIMRSLEVLPISTKNMLEESRVLHFIQRWAQNQTLPQAPELDGYSSENTSRA
QTPLNTPDGPPAKLGPELDGETPKRAVYRRLKIISENSLDSAMSDASKASDGKEEEEEEE
EDEEEDSLPVDAVVSSHTKPSAQVEEEVSAPGLEKQEPAEVKEEAVETGQLDEERTKGQK
GDVELAPDEERMEKDVGVEGAPGVTAPSESGQHSQNDETGPAPVKELSSPEVQEADTVAS
KGPAGSSEVAVLESVLEPDVGVSVCIAVETTVNTSTVMAETTESITTTQESAVEESAAST
VENVGSVIATAETTTVGSASTTTEVPGSAVPTAEAAATASTTTATDPVAVGTPSQDEEEG
VSDVESERSQEPPIRAVDISDMAARLLDSWKDLKEVYRIPKKSQVEKEPKERSRERDGPQ
SSRTPSGSRDRERDRERDRDRERERDRDLERTPRSTERRRRRSSHSPPLSAYERSSRRSD
DRYEHPNSSKKKVRPKERNKLTTEERRKLFEQEVAQKEAQKQQQQQQQQQLQALPYEMLG
YSPGPHGYMGYPPGYPIQTYVDPTNPNAGKVLLPTPSVEPLCAAGATVPYEQTPPQPLIS
ELGLASPSSAPPSQTAPTAGVPHMATTLELAPGTAQYVQSRAPSQDSVTVLSAAPPTGGP
QTQTQQGYTPVWSAAVPQPLTVQAQPAQPHTAIYYQGQACQAVYSIPTAYPQAGTPVIQT
YAEPATGYIQGQPVYTAHQQGVVLQQAGTVTTIVTAPTVQQDLIAPNSLMDLPPPSPPKP
KTIVLPPNWKVARDPEGKIYYYHVITRQTQWDPPCWEGGSDDASVGHEAEMDLGTPTYDE
NPSKFSTKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKSGRISNTEDFKHL
ARKLTHGVMNKELKSCKNPEDLECNENVKHKTKEYIKKYMQKFGPVYRPKEDTEVD
NT seq 8631 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgtttatgacccggaacacccgacagaggaaggaggtggagacactgtggtg
aaagaggaaagtctctctaagccaaccctgctcaagaaccttccaaccaagggtttgttg
tctagtcgcctcctacccaagggaacaaaatcaaaggtgaacctggaggagcatggccga
cagaaagtctctttcagcttcagccagacaaagaagcctctgccgaacctttttttgtcc
cagctcagtccagagaaatctccttgtgatctccagcttcctctcttgtcctctaataat
tcacagcagggtaaactagagctaaaagtggaaagtagaaatgaatcaacggggctgtct
tttccaacaccagtacctgagtccccactgtcagtcacctcccttccaaaatctaaatta
gagttggggaagatgcacttcaaaaaacaactcctgagtgtgtctgctagttttgaaaaa
ccagtggatgagcccaagcctaccatcaaacttgaggaagtgtcttcattgcaggagact
gtcctcaaacctgcaactaaaataactaccgaagctgcagtttctcagatccaactaacc
ttcaaagactgcatctctgaggaacatgtcataggagtgttggaggagaaccttaaccct
tctgttaagggttctacagatagctcccatattgggacagaaatcaaagagaaatttagt
gggttagaacaggctgatattccagaacaacataagagtcagtcccagtcagatagcacc
cttcctggttctgagtctgatggtgactcagtacgaacgtcttccagtcacaaatctggt
gaccccaggagtatggctaagacagataatcaaaacaaggatgcaaaaaggaacttttca
agagtggaggagtcagagaaattggagaagtcatcatcttatgcaaagtctgatgaaagg
gtgaaggaagaaaggtgctctacgcattcaaagtcagatcgtgagacaaggtactctcga
tcctctcgttctgacaaagagaggagaaggactaaaagccgctcgcggtccagatcgaga
gggtctcggacgagttcatcatactctagatctgaaaggtcatcaagaaatgaaagactg
tcaaggtcagataggtcacattaccatgattcagagaggagatcatacagaagcccatat
cgagaaaggagatcttcgcggtcgcggtctgatcgcaagtcccgggatagttcggactct
gaagatgattatcggagggcacgaacaggaagtaatcggtcctcaaaccattctagttct
cacagggactctaaatttttttactctaaatctgagaaggatgtgaaatgctcagaaatt
tctcgttcctctgagacagagaaaagaatacagttgcactctagatctgaaagatgccct
agaaaaattgaatttgagtccatcagaaaaacttcaccagaattagaatcagagtgtagg
aagtcaaatgcccattgcaaattggagtctaacatcaaatcccctctttcaaaatccaat
atctgttcccagaccatagacaaaaaacctcacaaaggtcattctagttctgactcagaa
gatgaccagaaagaaaagtccaagtttattaaactccccccctgctcaggactgaatgat
tcccagccagctatgtctgaaaaagattttaaggtgtcattgtctaagctcatagtaact
gatgctcaagtacaggataaattgaacaatacagaattaatacaaatgcagtcccactct
aacaagtattgtccttccagttttgaggatggcacacaatgtcagttaaactgtttgcca
agtaagcatattgacttaagtcaaagtaaagatactgccatccccagtaaggaaatgcat
cacctatctgtgcctgacccagtctctgctaatgactttgtgggtcaagactgtgaagag
gcagactctgttaatgtaactgtgagtagtggggccacactggcaccaacatacagcctg
cgctccaagtccaaaccacataaacacaactcttcacccccacctaaacttctgatagtc
aatacagactctgcacaacagtgccgatcgaatcaaagcttaaacaaaagtagttcagtg
gtctgtgacaccgtgttgcctgacagctgtgtatcatctgaaacattcacgaatgagcag
gacaaggaacagttatgcaagtatggccatactcttccagtggtcccagttgtattgaga
aaaaatgaaactggtgttctaagtgaacccagtaggaattcaagtccagcagtgctcagt
tgccaaccttactcaaaagataacacttcacctgggctttcagaggagtctatgatgtgt
gtggtatcttctgaaagattgtctaacttaagtggaatagaagtccttgagggtgctaat
gtcagttcagaatcaaatgctcatattaatgatagtattgaagttacaaatggcttccct
tcaaacaggcatgttcttcaaggacataactcatgtgaaggtgagggtcatgtggaatct
tctatcccagtttatagggagtctatagaaacaaagcattatgccaccgcgcaactatcc
agttatagcacatgtgttttaccagactgcagtccccctcagatttcacagaaagtatgt
aatccagcagaaatttccataaaggagttgtcacttggagatttgcaacagaaaactaaa
tcagaggacatctgtcatggtagcctagatgagactggttcacagtcttctgtagttcca
ccaaaatttgaatctaccaaggtttctgagctctcagttgcaagtcagcaatctgaacaa
ctgaatattaagactgaacagcagagtggtacattgttaaaaaataaaattaacctgaag
aagtcccgctgggatattgtaggacaggacaaatcggatcatgaacattctctcaaaatg
ccttgtcatgaaacaaaaccgtctgtgaaaaaaattatctcagttaagaaaatagagttc
tccaaagactctggcttggaacatgtcaagaactttgggactataaaaatgaatttgaac
aatgaaacggtgttgtctaaacaacattctgtgggaaaaaatcatgctagccttgaagat
aattcccttaaatctccacaaaaccagcttgatgcgaagacacaactgtctatgtctaca
caatcccaaccatgtgataccagcaacacaaatgtggacatctgttttgatcagaattac
aaagaacctccaaggtctagccatgctacatcgcggtctgttgcaaaggattggacacga
gacagtaaaacaggggggcacgatgtccttttagacaaattggaaaggaggaatacgagc
atcaatcaggatgttggaagccacagtgatgacagtgactctgaggagtcggattcagat
tcggatgactgtagcattcctaagaacagattgcactctgtggtagttgtgccaaaaaat
tctacccttacccagcctcatgattcaagagccacacttacatctttctccagtccaact
ggtagcccccatcagctgcctgcagactggcaggaacaggggtggagggggtccagtagt
aaagaatcaaatcgggcacatgatgcgtatagtgaagtttccggaaccctcagccctgtg
gaaaggcagaaaggattttctagccagcttcctgaaagcagtaagcatacccttcatgtt
ttgtgcactgaaaggcctattttgacgggccaacaaaatgtgacataccagtctcagagt
aatatggttgatagcacaagtcatgttgaagcttcacacacgtttgaagcccagcaatcc
aaggagcaaaagtccagtacttaccagaatccaaagatatcagtaccatccagctcggtg
gggtcattccacagctttgaaaccatgtggaggacatctgacccaggtcagtcacggccc
tgtgataggcccgatagctggcatgacaggaaaagtatattgatgcaccaacaacacgga
gaattttctagttcagatgacttaagcaataaggatggctataggtggggatgggatatt
ccacagccagagcagcctagcagcacatttcagcaaccagacagcagttacggtatccat
actcccaacccaatgctggtgggaagtcctgcattggggcagatgggtcagcatagcagt
ggttgctggattcaacccactgcttcacaaggttgcaggcctgtctacctctctgtgcct
tcactgtatcgtgagtctcttgacgaaatgcatcctgattccttgactaatgactatgaa
gaagaaagtcaggaaaatcatggcactgtaaccttctgcaaccatcctcctcctgcatcc
acctcttttgtccaaggccctgaaataagcagtaattgtaggggacttggtggtgtcttg
gacacccctagggaggatagtcagaaacctcacagaggcagaggtccgcccaaaaagaga
cgtccggagttcgagtcggactctgaaaatgaggcagaatcagaaaattctataaaaagg
gagcgtctggcagaacctgatgtctcaaggacttcaaaagaccctgtggacacaccaaac
cagactgcagaggtggaacggccatcacttagtcttcaagactttcaggatcctgttcgc
tggaaggatatggcaaagctcaaaaagatgccaccgtattttgatctgattgaagaaaat
atgtacctgacagaacgcaaaaagaacaagtcacaccgggacatcaagcggatgcaatgt
gagtgtgctgtgctgtcgagggaggagcgagctcgaggtgcgacagcgtgtggggaggac
tgcctcaaccgcttactgatgattgagtgctcctcacgatgcttgaatggctcttactgc
tcaaatcgacgctttcaaatgaaacagcatgctgactttgaagtcatcctgactgagaac
aagggctgggggcttcgtgctgccaaggacctggcaccaaacacctttgtgctggagtac
tgcggggaggttttggaccacaaggaattcaaagctcgcgtgaaagagtatgcccgcagc
aagaacatccattactacttcatggccttgaagaataatgagatcatcgatgctacgctg
aagggtaactgttcacgctttatgaatcacagctgcgagcccaactgtgaaacccagaag
tggacagtaaatggtcagctcagagtgggatttttcaccacgaagggagtctcagctggc
acagagctcacctttgactaccagttccaaagatatgggaaagaggcacagaagtgcctg
tgtggagcacccagctgtcggggcttcctgggtggagagaaccgggtaagcatccgggca
gcagggggcaagatgaagaaggagcgctcacggaagaaagattctgtcagtgctctcact
acggtggatgaagagttggaggcactactggagaatggggagggtctctctgatgagaaa
gaagttatttctctctgcaggctcatggtgcgagtagagacaatggaacagaaactcacc
tgtctcaaactcatccagaacactcagaatcccggttgcttgaagcagttcctggatcac
cacggactctctctgctatggattttcatggtggagctttcagaggccaagggcaactca
agcaacaacatcaaactgcagctggagattatgaggagtcttgaggttctgcccatctct
actaaaaacatgctggaagagagcagagtccttcacttcatacaacgctgggcccagaac
cagacgctgcctcaggctcctgagctggatgggtattccagtgagaacacatcgcgcgcc
cagactcctcttaacacccctgatggtccccctgccaaactagggccagagctggatgga
gagacaccaaagcgtgcggtgtaccgccgcctcaagatcatcagcgagaacagcttggac
agtgccatgtctgatgccagtaaggcttctgatggaaaagaagaggaggaggaggaggag
gaagatgaggaggaagactctttaccagtggatgctgttgttagtagtcataccaagcca
agtgcccaagttgaggaagaagtttcagctcctgggttggagaagcaggagccagcggag
gtcaaagaagaggctgtggaaacgggtcagctggatgaggagaggaccaaagggcagaag
ggagatgtggagcttgctccagatgaggagaggatggaaaaagatgtgggagttgagggg
gcaccgggtgtcacagcaccctccgaatcggggcagcattcacagaatgatgagactggg
cctgctccagtgaaggagctctcctcaccagaagttcaagaggctgacactgtggctagc
aagggccctgctggttcatctgaagttgctgtgttagagtctgtattggagcctgatgtt
ggggtgtctgtgtgtattgcagtggaaaccacagttaatacctcaactgtcatggcagag
accacagagtcaattacaacaacacaggaaagtgcagttgaggagtcagctgcttccacg
gtggagaatgtggggtctgttattgctactgcagaaacaacaaccgtgggatctgcttca
accactacagaggtaccaggatctgctgtgccaacagcagaagctgctgctactgcctct
accactaccgcaacagatccagtggccgtgggcacgccatcacaggatgaagaggagggc
gtgtcggatgtggagagcgaaaggagccaggagccaccgatccgggcagttgatattagc
gacatggccgcacgcctgttggacagctggaaagacctgaaggaagtatacaggatccct
aagaagagccaggtggagaaggagcctaaagagcgcagtcgagaacgagacggccctcag
tcatctcgaaccccatcaggcagccgcgaccgggagagagacagggaacgggaccgtgac
cgggaaagagagcgagaccgagacctggagaggactccacgcagcacagaacgccgccgc
agacgatcttcccactcccctcccttgtctgcctatgagagaagcagccggcggagtgat
gaccggtacgagcaccccaacagcagcaagaagaaggttcgaccaaaagagcgcaacaag
ttaacgacagaggagcggaggaaactgttcgagcaggaagtggcccagaaggaggctcag
aagcagcaacagcagcagcagcagcagcagctgcaagcgttgccctatgagatgttgggc
tactctccagggccacatgggtacatgggataccctccagggtaccctatacagacatat
gtggatcccaccaaccccaacgctggcaaagttctgctacccaccccttcagtggagcca
ctttgtgcagcaggggccactgtgccatatgaacagacacctccccagcctctgatatct
gaactaggactggcctcgccctcctcggcccctccctcccagactgcgcccacagcaggt
gtcccacacatggccacgacccttgagttggctccaggaacagcgcagtacgtgcagtcc
cgtgccccgtcacaggacagcgtgactgtgctttctgcggcaccccctacgggtggacca
cagacgcagacccagcagggctatactcccgtgtggagtgcagctgtgccgcaacctctg
actgtacaagcgcaaccggcacagccacacactgccatctactaccagggccaagcctgc
caggctgtgtacagcatccctactgcctacccccaggctggaacccctgtcatccagacc
tatgctgagcctgcaacaggctacatccagggtcaaccagtctacactgcacaccagcag
ggggttgtgctacagcaggcaggcactgtcaccactattgtcaccgcaccaaccgttcag
caggaccttatagcccctaacagcctgatggaccttccgccaccctccccgcccaaaccc
aagaccattgttcttccacccaactggaaagtggcgagggacccagagggcaagatctac
tactaccacgttatcacaaggcaaacgcagtgggaccccccatgctgggaaggaggcagc
gatgacgctagcgtgggtcacgaagcagaaatggacctcgggacaccgacatatgatgaa
aacccctccaagttctccactaagacagcagaggcagacacctctagtgagctggctaag
aagagtaaggaggtgttccgcaaagagatgtcacagttcattgtgcaatgcctgaacccg
taccggaaaccggactgcaaatcgggacgcatcagtaacacagaggattttaaacactta
gccagaaagctgactcatggtgtcatgaacaaggaactgaagtcttgcaagaaccctgag
gacttggagtgcaatgagaatgtcaagcacaagaccaaggagtatatcaagaagtacatg
cagaagtttgggcctgtatacagacccaaggaggacaccgaggtggactag

DBGET integrated database retrieval system