KEGG   Scleropages formosus (Asian bonytongue): 108927667
Entry
108927667         CDS       T04919                                 

Gene name
fen1
Definition
(RefSeq) flap endonuclease 1
  KO
K04799  flap endonuclease-1 [EC:3.-.-.-]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03030  DNA replication
sfm03410  Base excision repair
sfm03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108927667 (fen1)
   03410 Base excision repair
    108927667 (fen1)
   03450 Non-homologous end-joining
    108927667 (fen1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108927667 (fen1)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108927667 (fen1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfm04147]
    108927667 (fen1)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     108927667 (fen1)
DNA replication proteins [BR:sfm03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    108927667 (fen1)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     108927667 (fen1)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108927667 (fen1)
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108927667 (fen1)
SSDB
Motif
Pfam: XPG_N XPG_I 5_3_exonuc HHH_5
Other DBs
NCBI-GeneID: 108927667
NCBI-ProteinID: XP_018596606
LinkDB
Position
19
AA seq 380 aa
MGIHGLAKLVADQAPSAIKEHDIKSYFGRKIAIDASMSIYQFLIAVRQDGNMLQNEDGET
TSHLMGMFYRTIRMLESGIKPVYVFDGKPPQLKSGELTKRGERRAEAEKLLAQAQETGEQ
ENIDKFSKRLVKVTKQHNDECKKLLTLMGVPYIEAPCEAEASCAALVKAGKVFATATEDM
DGLTFGTNVLLRHLTASEAKKLPIQEYHFSRILQDMALTHEQFIDLCILLGCDYCGTIKG
VGPKRAMDLIRQHGSIEKILDNIDLSKYPAPEDWLYKEARELFREPEVVNCNSVELKWSE
PDEEGLVQFMCTEKQFSEDRIRNGCKKILKSRQGSTQGRLDTFFTITGSLSSKRKEPEVK
GSAKKKQKTSATPGKFKKGK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgggaattcacggccttgcaaagctggtagcagaccaggccccttcagccatcaaggag
catgacatcaaaagctattttggacggaagatagcgatagatgcatcgatgagtatttat
cagttcctgattgcagtgaggcaggatggcaatatgctgcagaatgaggatggagaaacg
accagccacctgatgggcatgttctacaggacaatccgcatgctggagagtggaatcaag
cctgtgtatgtgtttgatggcaagccaccgcagctgaagtcgggggagctgacaaagaga
ggggagcgtagagcagaggcagagaagcttctagcccaggcacaggaaacaggagaacag
gagaacattgataagttcagcaagcgccttgtgaaggtcaccaagcagcacaacgacgag
tgcaaaaagctcctcaccctcatgggcgtgccctatatcgaggcaccctgtgaagcggaa
gccagctgtgctgcgctcgtgaaggcggggaaggtctttgccacggcgacggaggacatg
gacggcctgacgtttgggacaaacgtcctgctgaggcatctaaccgccagcgaagccaag
aaactgccgattcaggaatatcatttcagccgtattcttcaggacatggctttgacgcac
gagcagttcatagacctgtgtatcttgctgggctgcgattactgcggcacaatcaaaggt
gtaggacctaaaagagccatggacctcattcgacagcacggctccattgagaagattctg
gacaacatcgacctttctaaatatcccgcaccagaggactggctgtataaggaggctcgt
gagctgttcagggaaccagaggtggtgaactgcaactctgtagaactcaaatggagtgag
ccggacgaagaaggactcgtccagttcatgtgcactgagaaacagttcagtgaggaccgt
atccgtaacggctgtaagaagattctgaagagcaggcaaggcagcactcagggtcgcctg
gacacctttttcaccatcacggggtcgctgtcgtccaaacgcaaggagcctgaggtgaaa
gggtcagccaagaagaaacagaaaacaagtgcaactccaggaaagttcaagaagggcaag
tag

KEGG   Scleropages formosus (Asian bonytongue): 108933391
Entry
108933391         CDS       T04919                                 

Definition
(RefSeq) probable flap endonuclease 1 homolog isoform X1
  KO
K04799  flap endonuclease-1 [EC:3.-.-.-]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03030  DNA replication
sfm03410  Base excision repair
sfm03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108933391
   03410 Base excision repair
    108933391
   03450 Non-homologous end-joining
    108933391
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108933391
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108933391
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfm04147]
    108933391
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.-  
   3.-.-  
    3.-.-.-  
     108933391
DNA replication proteins [BR:sfm03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    108933391
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     108933391
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108933391
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108933391
SSDB
Motif
Pfam: XPG_I XPG_N 5_3_exonuc HHH_5 DPRP
Other DBs
NCBI-GeneID: 108933391
NCBI-ProteinID: XP_018605908
LinkDB
Position
23
AA seq 387 aa
MVSWSVVIRQRCKWRHRTEGASSCAVCATASLSHKNKETASLATMGISKLAELIRSDAPN
AISYKKTGDYSGKVIALDTSIILSQFRSAVPQLGKLSHLTGLFFRTLHFLEHDIKPVFVF
DGTPPAQKKNELEKRAKTAGYTGSYIKGKDSPHIQDCKRILQLLGVPCIQAPGDGEAFCA
QLVKEGKVHAVASEDMDTMPFGSELLIRQFDAKKEGDVMEYSLSKLLDILQLTHKEFVDL
CILLGCDYCEKIQGLGPRRALKLIQQYKTIEDVVLHVNRKTHPIPVSWKYQEARRLFLET
QQSDQPDLIWTEPNEEELVHFLCEEKHINVSRVRGRMQKFHKMLQERRKEREENSKQARM
EDFFRVTRRRQSLMEGQGPSNKKARYQ
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggtgtcgtggtctgtcgttatccgccagcgctgcaagtggcgccatcgcactgaaggg
gcctctagttgtgctgtgtgcgccacagcctcgctttcacacaaaaacaaagagactgct
tcgctcgcaacaatgggcatcagtaaactggcggagttaattcgcagtgatgcaccaaat
gccatctcgtacaagaaaacaggcgactattcaggaaaagttattgccctggacacctct
atcatactcagtcaatttcgcagtgctgtccctcaattagggaaactaagccacctcaca
ggcctgttcttccgcactctgcacttcctggagcatgacatcaagccagtctttgtgttt
gatgggacaccgccggcgcagaagaagaatgagctggagaaaagagcgaagaccgcaggt
tacactggttcctacattaaaggcaaagattcccctcacatccaggactgtaagcgcatc
ctgcagcttttgggagtgccttgcattcaggctccaggggatggggaggcgttctgcgca
cagctggtaaaggagggcaaagttcatgctgtggcctcggaggacatggacacgatgcct
tttgggagcgaactactgatccgccagtttgatgccaagaaggaaggtgatgttatggaa
tactctttatctaagctgcttgatattctgcagctgactcacaaagagtttgtagacctg
tgcatcctgctggggtgtgactactgtgagaagatccagggccttggtccacggagggca
ctgaagctcatccagcagtacaagaccattgaggacgtggtgctgcatgtcaacaggaag
acacatcccattcctgtgagttggaaataccaggaggcacgcaggttgtttttggaaaca
cagcagagtgaccaaccagacctgatttggacagagcccaatgaggaggagctggtccat
ttcctgtgtgaggagaagcacatcaatgtgtctagggttcgagggcggatgcagaagttt
cataagatgctgcaggagaggaggaaagaacgtgaggaaaacagcaagcaggcacgcatg
gaagactttttccgcgtgactcgtaggaggcagagcttgatggagggccaagggcccagc
aacaagaaagccagatatcagtga

DBGET integrated database retrieval system