KEGG   Scleropages formosus (Asian bonytongue): 108927961Help
Entry
108927961         CDS       T04919                                 

Gene name
gpd2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108927961 (gpd2)
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     108927961 (gpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 FAD_binding_2 FAD_oxidored EF-hand_8 Pyr_redox_2 GIDA NAD_binding_8 EF-hand_5 EF-hand_4 HI0933_like EF-hand_9 Thi4 SPARC_Ca_bdg CEP19
Motif
Other DBs
NCBI-GeneID: 108927961
NCBI-ProteinID: XP_018597178
UniProt: A0A0P7VNZ9
LinkDB All DBs
Position
Unknown
AA seq 727 aa AA seqDB search
MAFRKAAKGTALVGSGALAALYGLSQFSEYRRNQARLAHVEAAEQVQMTHQDELPSRQAQ
LATLKSTEEFDILVIGGGATGSGCALDAVTRNLKTALVERNDFSSGTSSRSTKLIHGGVR
YLQKAIMKFDYEQYMMVKEALHERSNLLDIAPHLSAPLPIMLPVYKWWQLPYYWLGIKMY
DLVAGSQCLKSSYVLSKTKALELFPMLKKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AAIANYTEVVHLLKKTDPQTGRKRVCGARCRDQITGQEFDVRAKCVINATGPFTDSVRKM
DDQRNPNICQPSAGVHIVIPGYYSPDNMGLLDPATSDGRVIFFLPWEKMTIAGTTDTPTD
VTAHPIPMEEDINFILTEVRNYLSPDVEVRRGDVLAAWSGIRPLVTDPSSKDTQSICRNH
IVNISESGLVTIAGGKWTTYRSMAEETLDAAVKEHKLSGGPSQTVGLMLEGAKDWSPTMY
IRLVQDYGLEIEVAQHLASTYGGRAFEVAKMAQVTGKRWPIVGKRLVSEFPYIESEVLYA
VKEYACTTIDVIARRTRLGFLNVQAADEALPRIVEIMGKQLRWSEQKKREELAAAKQFLY
HEMGYKARSEQLTNMSEIALTPSEVDRYKKRFHKFDKENKGFITTVDVQQVLESISIQID
ENTLHEILNEVDLNKNGQVELNEFLQLMSAVQKGQVSDSRLAILMKTVEESLEQREPVSV
DRSGGGV
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcattccgaaaagcagccaagggcacagcgctcgttggaagtggggccttggcagcg
ctctatggcctgtcgcagttttccgaatacaggagaaatcaggcccgactggcacacgtg
gaggcagcagaacaggtgcaaatgacccatcaggatgagctgccatcccgacaggcccag
ctggctactttgaagagcacagaggagtttgacatcttggtcattggtggaggagccaca
gggtcaggctgtgccttagatgcggtcacacgaaatctgaaaacagccctcgtggagcgg
aatgatttctcatcagggaccagcagtcggagcaccaagctcattcacggcggagtccga
tatctacagaaagccatcatgaaatttgattacgaacagtatatgatggtaaaagaagca
cttcacgagcgctccaacctgctggacattgctcctcatttgtctgccccgctgcccatc
atgctgcccgtctacaagtggtggcagcttccgtactactggcttgggataaagatgtat
gacctcgtggccggatcgcagtgtttgaagagcagctacgtcctcagcaagacaaaggcg
ctggagctcttccccatgcttaagaaggacaagctggtgggagccatcgtctactacgat
ggacaacacaacgatgctcgaatgaacctcgccatcgccctcactgctgccaggtacggg
gctgccattgccaattacactgaagtggtgcacctactgaaaaagacagacccccagacc
ggcaggaagagggtctgtggcgcccgttgcagggaccagatcacagggcaggaatttgat
gtcagagccaaatgtgttatcaatgccacgggacctttcaccgactcggtgaggaaaatg
gatgatcagagaaaccccaacatatgtcagcccagtgcgggggtgcatatcgtcatccct
ggctattacagcccagacaacatgggactcctagaccctgccacgagcgacgggcgggtc
atctttttcctgccctgggagaagatgaccattgccgggacgacagacacacccacagac
gtcacggcccatcccatccctatggaggaggacatcaactttattctcaccgaggtccgc
aactacctgagccccgatgtggaagtgagaagaggagatgttttggctgcctggagcgga
atccgtccattggttacagaccccagttctaaggacacccagtccatatgccggaaccac
attgtgaacatcagtgagagtggattggtcacaattgctggtgggaagtggactacctac
cgctccatggctgaggagacgctggatgctgcagtcaaggaacacaagctatctggaggt
ccgagtcaaacagtaggcttgatgctggaaggcgccaaggactggagccccaccatgtac
attcgcctggtgcaggactacggactagaaattgaggtggctcagcatctggcttccacc
tacggagggagagcattcgaagtggccaaaatggcccaggttaccggaaaacgatggcca
atagtggggaaacgcctcgtgtctgaattcccttacattgagagtgaggttttgtacgcc
gtcaaggagtacgcctgcactaccattgatgtgatcgctcggcgcacacggctgggcttc
ctgaacgtacaggcagccgacgaggccctgccccgcattgtggagatcatggggaagcag
ctgaggtggagcgagcagaagaagagggaggagttggctgctgccaaacagtttctgtat
catgagatgggctataaggccaggtccgagcagctgaccaacatgtcggagattgccctc
acgccttcagaggttgacaggtacaagaagcggttccacaaatttgacaaagaaaataaa
ggcttcatcaccactgttgatgttcagcaagttttagagagcatcagcatccagattgac
gaaaacacgctgcatgaaattctaaatgaagttgacctaaacaaaaacggacaagttgag
ctcaacgaattcttacagctaatgagtgccgtgcagaagggccaggtgtctgacagccgg
ctggccatcctcatgaagacggtggaggagagccttgagcagagggagcccgtctctgtg
gacaggagtggcggtggggtgtga

DBGET integrated database retrieval system