KEGG   Scleropages formosus (Asian bonytongue): 108928062Help
Entry
108928062         CDS       T04919                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00020  Citrate cycle (TCA cycle)
sfm00190  Oxidative phosphorylation
sfm01100  Metabolic pathways
sfm01200  Carbon metabolism
Module
sfm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sfm_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108928062
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108928062
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     108928062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 108928062
NCBI-ProteinID: XP_018597350
UniProt: A0A1W4Z9F1
LinkDB All DBs
Position
Unknown
AA seq 285 aa AA seqDB search
MSAVFFTLSRGGLIVAARHPAGALIMRCAQTAAAAAPATQPRLKKFQVYRWDPDTPGDKP
RMQTFEVDLNSCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNINGGNTLACLNR
IDTNTSKAAKIYPLPHMYVVKDLVPDMSNFYAQYKSIEPYLKKKDESKQGKEQYLQSVED
RQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLSKLQD
PFSLYRCHTIMNCTQTCPKGLNPGKAIAEIKKMMTTYKEKRSSAV
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgtgtttttcaccttgagtcgcggtgggctcatcgtggcggccaggcatccc
gccggcgcactgatcatgcgatgtgcgcagacagcagctgctgcagcaccagccacacaa
ccccggctgaagaagttccaggtgtaccggtgggaccctgacacccctggggacaagccc
cgtatgcagacatttgaggttgatctgaacagctgtggtcccatggtgctggatgcgctc
attaagatcaagaacgagattgaccccactctcacgttccgccggtcctgccgggaaggt
atttgcggatcctgtgctatgaacattaatggtggcaacacgctggcctgcttgaacagg
atcgataccaataccagcaaggcagcaaagatctaccccctgccacacatgtatgttgtc
aaggaccttgtacctgacatgagtaacttctatgcccagtacaagtccattgagccctac
ctgaagaagaaggatgagtccaagcagggcaaggagcagtatcttcagtctgtggaggac
aggcagaagctggatggactgtatgagtgcatcctgtgtgcctgctgtagcaccagctgc
cccagctactggtggaatggggacaagtacctgggccctgctgtcctcatgcaggcatac
cgctggatgattgactcgcgtgatgatttcacagaagagcgcctatccaaacttcaggat
cccttttccctataccgctgtcacaccattatgaactgcacccaaacttgccccaaggga
ctgaaccccggaaaggcaatagcagagatcaagaaaatgatgacaacttacaaagagaag
agatcatctgctgtgtga

DBGET integrated database retrieval system