KEGG   Scleropages formosus (Asian bonytongue): 108928209Help
Entry
108928209         CDS       T04919                                 

Gene name
lct
Definition
(RefSeq) lactase-phlorizin hydrolase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00052  Galactose metabolism
sfm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    108928209 (lct)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     108928209 (lct)
    3.2.1.108  lactase
     108928209 (lct)
Chaperones and folding catalysts [BR:sfm03110]
 Intramolecular chaperones
  Others
   108928209 (lct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 108928209
NCBI-ProteinID: XP_018597559
UniProt: A0A1W4Z170
LinkDB All DBs
Position
Unknown
AA seq 1904 aa AA seqDB search
METKLLLVLLLLGPGADAGAHDGRGGGQQDFMLLAGPLGERPAVGPLLSSGGVQQDVPLC
EKSSPAEWTPHFEYLQSRGVTHFKVPLSWSLLLPTGDPERPLRRTVACYRALLGQLSKAH
LKPLVVLHGAGVPEPVGVAPGGWYTHRVVSAFQSYAEFAFAAFGDLVDTWITFSDVHALL
EGGVSPAQRTTMLENILLAHRTTYRIYHGRFPGGRVGLGIGTRDASILFQHEVTGEAISD
FLSIQLKVDCTANSALEEQLTHLQAGGDKGPLLIYQLDVEGCASERGDEFEPLISILNAL
KRTELQVLGCDIVDLFDQLTADTAPKRQLDHSRSPSSYQKVWEKFSTQSPSERDDFLWDL
FPEGFQWSTSSEAFKVEGGWAEHGKGETIWDRFTHSGQAFANQTGDLACDSYNKVDYDAY
LLRGLLVTTYQFSISWARVFPSGRRGSLSEKGARYYDRLIDALVSSAVRPVVTLHHWDLP
QALQDDGGWSNASIIEAFREFADFCFARYGDRVKTWNTFSSPWVISIAGYGTGEHPPGIT
DPIISSYQVTHNMLKSHAEAWHVYNDKYRQQQGGKVGIALNSDWAEPQDPSRPQDISAAE
RYLQFMLGWFAHPIFVDGDYPPSLKSQVEQKRQECPQAEPAQLPTFNEIEKKRIRGTADF
FGLNHYTSRLVNDTFGGCVPGPRGVGDFQEHIDPAWPLTASEWIRSVPWGLRRLLSFIAA
EYTSITKVPIYITGNGMPTQFGGDVFNDTERILFLKSYINEALKAVRLDGVDVRGFTVQS
LMDGFEGPQGYSERFGLHYVNFEDPNRPRTPKASAYFYSKVIENNGFVGLREKMVLPKHV
PQPRTTKLVRLPPSEVPSKSKVVWEKFSHQSNFERKLYHYGTFPEGFEWGVSSSAYQVEG
GWNADGKGASVWDTFTHKPGSIVNNANGDVACDSYHRADEDLYMLRALRVKSYRFSLSWP
RIFPDGSRASLNQQGVNYYNKLINGLVASNITPMVTLHHWDLPQALQDIGGWENVSMINY
FDEFCDFCFATFGDRVKFWMTFNEPYVIAWVAHGQGLLPPGIKNPGYAPYQVAHNLIKAH
AKVYHIYDERYRKTQGGLVSISLNADWVEPKDVDVFREVAAADRALQFRLGWFAHPIFKN
GDYPDAMKWMVGNKSELQGLPASRLPAFTDEEKEYIQGTADVFCINTYTSEIVHHVTSLL
SPPSYDYDQDVREAEMDDSPATAMKGLRVVPWGLRRLLNWIKEEYGNPEIYITENGMSTD
SKTTVDDTDRVFFYKTYIDEALKAHNLDGVKLKGYIAWSLLDSFEWLNGYSIGFGLHHVD
FNHPERPRTPKRSAHYYYDIMRNNGFPLPDEEKLLYARFDKGFAWSTSTASYQIEGGWRA
HGKGLSIWDKFAHTPLKVGNDDNGDVACDSYNKIREDVAALRTLGVTHYRFSVSWPRVLP
DGTTGKVNEAGLDYYRSLVDALLAANIQPQVTLYHWDLPLALQDQGGWENETIVQHFKEY
ADFIFSRLGDKVKFWITINEPYNVAQIGHGYGTAAPGISFRPGTLPYIVGHHLLKAHAEA
WHVYNDKYRSKQGGVISITINSDWAEPRNPYKQEDIDAARRFLQFYIGWFAHPVFNGDYS
DVMKTVVRERSLAAGLPRSRLPEFSADEVQRIRGTYDYFGFNHYTTVLTYKLDYKNLQHY
DADRGVATVTDPSWLDSGSFWLKVTPHGFRKILNFIKEEYGDPPVYITENGVSERGPVHL
NDVRRIHYYRNYLNQALKAKVLDSVDIRGYTAWTLMDNLEWATGFAERFGLFYVNRSDPT
LPRVPKESAAYYATVIACNGFPDPALGPDPCLTPEPEETSTPPTTSPAPVQGVKFMGGEM
SPPDAEVALYILFSLSLVGAVLLVLMSYRYWRGTNRRKWVRAED
NT seq 5715 nt NT seq  +upstreamnt  +downstreamnt
atggagacaaagctcttgctggtgctcctgcttctcggtcccggtgccgatgccggggcc
cacgacggtcgaggcggggggcagcaggacttcatgctgcttgcggggcccctgggcgag
cggccggccgtaggtccgctcctgtcatcgggaggcgtccagcaggacgtcccgctgtgt
gagaagagctctcctgcggagtggacacctcacttcgagtacctgcagtccaggggagtg
acgcatttcaaagtgcccctgtcctggtctctgctgctgcccaccggagaccccgagcgc
cccctgcggcgcaccgtggcgtgttaccgcgccctgctggggcagctgagcaaagcgcac
ctcaaacccctggtggtcctgcacggtgcaggggtcccggagcccgtgggagtggcccct
gggggctggtacacccacagggtggtcagcgctttccagagctacgccgagtttgccttc
gcggcgttcggcgatctggtcgacacctggatcacgttcagcgatgtccacgcgctgctc
gaggggggggtctccccagcccagaggaccaccatgctggaaaacatcctcctcgctcac
agaaccacgtaccgcatttaccacggccggtttcccgggggtcgtgtcggacttgggatc
ggcaccagagatgcgtccatccttttccagcatgaggtcaccggtgaggcgatctctgac
ttcctgtccatccagctcaaagtggactgcacagccaactcggctctggaggagcaactg
acacatctgcaggcgggaggagacaaggggccccttttaatctaccagctcgacgtcgag
ggatgtgcctcggagcgcggggatgagttcgagcctctcatcagcatcctcaacgccctt
aagagaacagagctgcaggtcctgggctgtgacatcgttgatctctttgaccagctaact
gcggacacggccccgaaaagacagctggatcactcccgttctccttcctcataccaaaag
gtgtgggaaaagttcagcacccagtctccgtcagagagagacgactttctgtgggacttg
tttccagaggggttccagtggagcacgtccagcgaggctttcaaagtggaggggggctgg
gctgagcacggcaaaggagagaccatctgggaccgctttacccacagcgggcaggcgttc
gccaaccagacaggtgaccttgcctgcgacagttacaacaaggtcgactacgacgcctat
ctcctgaggggcctccttgtcactacctaccagttctccatctcctgggcccgcgtcttc
ccgtccggccgccgcggcagcctcagtgagaaaggggcccggtactacgacaggctcatc
gacgcactcgtgagctctgccgttcgaccggtggtcaccctgcatcactgggacctgcct
caggcgctgcaagacgacggaggctggagcaacgcatccatcatagaggccttcagagaa
tttgcagatttctgcttcgccaggtatggtgaccgtgtgaagacctggaacaccttcagc
agcccttgggtgatcagcattgctgggtatggcacaggggagcaccctccaggtatcaca
gaccccatcatcagctcctaccaggtgactcacaacatgctgaaatcccatgctgaggcc
tggcatgtctacaatgacaagtatcgtcaacagcaaggcgggaaggtgggcattgccttg
aactcagattgggcggaaccacaagacccttccaggccccaggacatatcagcagcagaa
cggtatctacagttcatgcttggctggttcgcccatcccatattcgtggacggtgactac
ccaccatcactgaagagccaggttgagcagaaacggcaggaatgtccccaggccgaaccg
gctcagctccccaccttcaacgaaatcgagaagaaacggatccgaggaacagctgacttc
tttggactgaaccactacacatcccgactggtcaatgataccttcggaggctgcgtccca
ggacctcgtggtgtgggtgacttccaggagcacattgaccctgcctggccacttaccgct
tcagaatggatccgttctgtcccctggggtttacgccggttgctgagcttcatagctgca
gagtatacgtccatcaccaaggtgcccatctacatcacaggaaatgggatgcccacccag
ttcggcggagatgtgttcaacgacacagagcgaattctctttctcaagagctacataaat
gaagcgttgaaagctgttcgcctggatggagtagatgtccgaggttttactgtgcagtca
ctcatggatggatttgaaggcccacaaggctacagtgagaggtttggtttgcattatgtc
aactttgaggaccccaatcgaccgagaactccaaaagcgtcagcttacttctactccaag
gttattgaaaacaatggctttgtgggcctgagggagaagatggtgctgccaaagcatgta
cctcagccccgcaccacaaagctagtccgtttgcccccttccgaggttcccagcaaatcc
aaggttgtctgggaaaaattttcacaccagtccaacttcgagagaaagctgtaccactat
ggcaccttccccgagggattcgagtggggtgtttcatcctcagcctaccaggtcgaggga
ggctggaatgctgatgggaaaggagccagtgtgtgggacacctttacccacaagccgggc
agcattgtaaataatgccaatggggacgtggcgtgtgacagctaccacagagccgacgaa
gacctttacatgttgagagctctgagggtgaagtcctacaggttctcattatcctggccc
aggatctttcctgatggttcaagagcatctctaaaccagcaaggtgttaactactacaac
aaactaattaatggtcttgttgcttccaacataacgccaatggtgacgcttcaccactgg
gaccttcctcaagccctgcaggacattggcggctgggaaaatgtctccatgatcaactac
tttgatgagttctgcgatttttgctttgccacttttggagacagggtgaagttttggatg
accttcaatgagccctatgtcatcgcttgggtggcacatggacaagggttgctccctccc
ggaattaagaatccaggttatgccccttaccaggtggctcacaacctcataaaagcacat
gccaaggtttaccacatatatgatgagaggtacagaaaaactcagggtggcttggtctcc
atcagcctcaacgctgactgggtggaacccaaggatgtcgacgtcttccgagaggtggca
gctgctgaccgtgctctgcagtttcggttgggctggtttgctcatcccatctttaagaat
ggggactacccagacgccatgaaatggatggtgggcaacaagagtgagttgcagggtcta
ccagcatccaggctgcctgctttcacggacgaggaaaaagaatacatccagggaaccgca
gatgtcttctgcatcaatacatacacctcggaaattgtacatcacgtgaccagcctgctc
tctcctccttcctatgactatgatcaggatgtccgcgaagcagagatggatgactccccg
gccacagcaatgaagggactcagagttgttccttggggtttgagacgactcctaaactgg
attaaggaagagtatgggaaccccgagatttacatcacagaaaatggaatgagcacagat
tccaagacaacagttgatgatacagacagagtcttcttctacaaaacctacatcgacgaa
gcgctgaaagcccataatctggatggagtgaagctgaaaggatacatcgcttggtctctt
ctcgactctttcgagtggctcaacggctacagcattggctttggtctccaccatgtggac
ttcaaccacccagagcggcccaggacgccgaagcgctcagcccattattactatgatatc
atgagaaacaacggcttccccctccctgatgaggaaaagctgctgtacgcgcgtttcgac
aaaggcttcgcttggagcacatctacggcatcctatcagatcgagggaggatggagggct
catgggaagggcctgagcatctgggacaagtttgctcacactcccctgaaggtgggcaac
gatgacaacggggacgtcgcttgtgacagctacaacaagatccgagaggacgtggctgcc
cttcggacactcggggtgacgcactaccgcttctccgtatcctggcccagggtgctgccc
gatgggaccacggggaaagtcaatgaggccgggctggactattaccggagcctggtggac
gcacttctggctgccaacattcagccgcaggtcaccctgtatcactgggaccttccgttg
gccctgcaggaccaaggtggctgggagaatgaaaccatcgtgcagcactttaaggagtat
gctgacttcatcttcagccgtctcggagacaaagtgaagttctggatcaccatcaacgag
ccctacaacgtggcccagattggccacggctacggcacggccgctccaggtatcagcttc
cggccggggacgctgccctacattgtaggtcaccacctgctcaaggcccacgcggaggcg
tggcacgtgtacaacgacaagtaccgcagcaagcagggcggcgtcatctccatcaccatc
aactcggattgggcggagccccgcaacccctacaagcaggaggacatcgatgcggcccga
cgcttcttacagttctacatcggctggtttgctcatcctgtgttcaacggagactacagt
gacgtgatgaagacggtcgtcagagagaggagtctcgctgcaggtcttcccagatctcga
ctccctgagttttccgcagacgaggtgcagagaatcagaggaacctacgattactttggc
ttcaatcactacaccaccgtcctgacctacaaactcgactacaagaacctgcagcactac
gacgcagacaggggcgtcgccaccgtcacggaccccagctggctggactcggggtccttc
tggctgaaagtcaccccccacggattccggaaaatcctcaacttcataaaggaggagtac
ggcgaccctcccgtttacatcacggagaacggcgtgtcggagcgcggccccgtccacctg
aacgacgtccgcaggatccactactacaggaattacctcaaccaggcgctgaaagccaag
gttctcgacagcgtcgatatccgcggctacacggcctggaccctcatggacaacctggag
tgggcgacgggtttcgccgagaggttcggcctcttctacgtgaaccgctccgaccccacg
ctgccccgcgtgcctaaggaatccgccgcttactacgccaccgtcatcgcctgcaacggc
ttccctgacccggcgctgggtcccgacccctgcctgaccccggagcccgaagaaacaagc
accccccccacgacctcgcccgcccccgtccagggagtgaagttcatgggaggggagatg
tcgccccctgatgccgaggtggccctttacatccttttcagtctctccctagtcggtgcc
gtcctgcttgtcctcatgtcctacagatactggagggggacaaacagacgcaaatgggtc
agagcagaggactga

DBGET integrated database retrieval system