KEGG   Scleropages formosus (Asian bonytongue): 108928279
Entry
108928279         CDS       T04919                                 

Gene name
lig3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108928279 (lig3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108928279 (lig3)
Enzymes [BR:sfm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108928279 (lig3)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     108928279 (lig3)
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C RNA_ligase BRCT_2 mRNA_cap_enzyme
Other DBs
NCBI-GeneID: 108928279
NCBI-ProteinID: XP_018597679
LinkDB
Position
25
AA seq 1008 aa
MHRLVFFKALRRLFSLPIDKPFRNQSFVGSAQTCCFRLYTRIVPPRTKCVFSGPGNSCHQ
TQASQALSLSVPYLIRIDPAGMAEQRYCVEYAKRGTAGCKKCKDKIMKGLVRIGKIVPNP
FSESAGEMKEWYHVKCIFEKLERARATTKKIEDITDLEGWEEIEDEDKDLINKHIAELAA
KTNASPKKKVQAKLNSSGQLTTPPPEPSTNAPRKFSGFTATKAGTTSSPSASPAKADQGS
KLSAQMCDPSHKDCLLREFRKLCAMVAEKPSYNVKTQIIQDFLRKGSGGDKFRGDLYLTV
KLLLPGVVKSVYNLNDKQIVKLFSRIFNCNQEEMVRDLEQGDVSETIRIFFEASKSFPPA
PKSLLTLQEVDTSLTRLAQLTKEDDQQRELELISKKCTANDLKCIIRLIKHDLKMNAGAK
HVLDAVDPNAYDAFKASRNLGDVIDRVLQNQQESSNGSGPKKILSVEASLMTPVQPMLAE
ACKSIEYAMKKCPNGMYSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVNHFKEFIPQ
AFSGGHSMILDAEVLLIDTNSGKPLPFGTLGVHKKAAFKDAQVCLFVFDCIYFNGVSLMD
KPLCERRKFLHDNMVEVPNRIMFSEMKHVTKAGDLAEMITRVIREGLEGLVLKDVKSPYE
PGKRHWLKVKKDYLNEGAMADSADLVVLGAFYGKGSNGGIMSSFLMGCYDPASKKWCTVT
KCSGGYDDATLARLQNELDVIKISKDPSKIPSWLKIVKNYYPDFIIRDPENAPVWEITGA
EFSKSEMHTADGISIRFPRCTQIRDDKDWKSATNLPQLKELYRISKERSDFEVKAGPSKD
SSNKSSSGGDSGENSPLPSSRAPVTSSKTGTSNNPKAKAVKTESPSSAAKRKMPTEERGG
KKPKKSEPVNSNGQSKLKAGLPQTAGPMKEKTLLDIFSGVKLFMPESVQDYQKLRRYFVA
YDGDLVADYDATSATHTLGEPEEDSETRKVTTNWIWECIRKRRVVPPC
NT seq 3027 nt   +upstreamnt  +downstreamnt
atgcatagacttgtgttttttaaagcattaagaaggctcttcagcttacctatagataag
ccgttcaggaatcaatctttcgttggatctgcccagacttgctgttttagattatacacc
cgcattgtacctcctcgtaccaagtgcgtcttttctgggcctggcaacagctgccatcag
acgcaagcatctcaagccctcagcctctcggtcccctacctcatccgcattgacccagca
ggcatggcagagcaacggtactgtgtggagtacgcaaagcgcggcaccgccggctgcaag
aagtgtaaggataagatcatgaaaggcctcgtacgcattggcaagattgtacctaacccc
ttcagcgaatcagctggggagatgaaagagtggtatcatgtgaagtgtatcttcgagaag
cttgagcgtgccagggcaaccacaaagaaaattgaagacattacagacctggagggctgg
gaggagatagaggacgaggacaaagatctcatcaacaagcacattgccgaattggctgct
aagacaaatgcaagtccaaagaagaaggtgcaagcaaagctgaacagcagtggacagtta
acaactcccccgcctgaaccatccaccaacgctcctcggaagttctccggcttcacggct
accaaagccggcaccaccagcagccccagtgcctctcctgccaaagctgatcaagggagc
aagctgtccgctcagatgtgtgatcccagccacaaggactgtctgttgcgggagttccgc
aagctgtgcgccatggtggctgagaaacccagctacaatgtcaaaacgcagatcattcag
gatttccttaggaaagggtctggcggagataagtttaggggggacctgtacctgacagtg
aagctgcttctccctggcgtggtcaagagtgtgtataatttaaatgacaagcagatagtg
aagctgttcagtcgcatattcaactgcaaccaggaggagatggtacgcgacctggagcag
ggagacgtttctgagaccattcgtatctttttcgaggcgagtaagtccttccctccggcg
ccaaaaagtctcctcactctccaggaggtggacacctctttgacgcgtctagcacaactc
accaaagaggacgaccaacagagagagctggaactcatatccaagaaatgtacagcaaat
gaccttaaatgcatcataagacttatcaagcatgatttaaaaatgaatgctggagctaag
cacgtcttagatgctgtggatcccaatgcttacgatgcgttcaaggcctcccgtaacctt
ggcgacgtcattgatcgagtgctgcagaaccagcaggaatcatccaatggctcgggacca
aagaagatcctgagtgtagaggcgtccctcatgactcctgtccagcccatgttggcggag
gcgtgcaagtcgatagagtatgcgatgaagaagtgccccaacgggatgtattctgagata
aagtacgacggggagcgggttcaagtacacaaaaatggggaccacttcagttatttcagc
cgcagtctcaaaccggtgctgccacacaaagtgaaccattttaaagagttcattccccag
gccttttctgggggtcacagcatgattctggatgcggaggtgcttctgattgacaccaac
agtggcaaacccttgccctttggcactctgggcgtgcacaagaaagctgccttcaaagat
gcacaagtgtgtttatttgtgtttgactgtatttactttaatggcgtgagcttgatggac
aaacccctttgtgagagaagaaaatttctccatgataacatggtcgaagtgccaaacaga
ataatgttctctgaaatgaagcatgttactaaagcaggagatctagcggaaatgatcacc
cgtgtcattcgcgagggactggagggactggtcctaaaggacgtcaagagtccatacgaa
ccaggaaagagacactggttgaaggtgaagaaggactacctgaatgaaggggctatggca
gacagtgcagaccttgtggttttaggggctttttatggaaaagggtccaatggtgggata
atgtccagtttcctaatgggctgctatgatcctgcatcaaagaagtggtgcacagtgacc
aagtgctctggtggttatgatgatgcaacactggcccgactgcagaatgagctagatgtg
atcaaaattagcaaggaccccagcaaaatcccaagctggttgaaaattgttaaaaattat
tatccagacttcattatccgggacccagaaaatgccccagtgtgggagatcacaggagca
gagttctccaaatctgagatgcacactgccgacggcatctccatacgcttcccccgatgc
actcaaattcgggatgacaaggactggaagagtgccacaaatctcccccagctgaaggaa
ctgtacagaatttcaaaggaaaggtctgactttgaggtgaaggcaggaccctcgaaggat
agcagcaacaagagctcctcagggggtgacagtggggagaactctccattgccttcatct
cgtgccccagtaacatccagcaagactggaactagcaataaccccaaagcaaaagcagtg
aagacggagagtccctcatcagcagccaaaaggaaaatgccaacagaagaacgcggcggg
aaaaagccgaaaaagtcggagcccgtgaacagcaatggtcaaagcaagttgaaagccgga
cttcctcaaactgcaggacccatgaaggaaaagaccttactggacatattcagcggcgtg
aaactcttcatgcccgagtcggtacaggactatcagaaactgagaaggtattttgtggct
tacgatggagatctggtggcagattatgatgccacctcggctacacacaccctgggagaa
cctgaggaggacagcgagacgcggaaggttaccaccaactggatctgggagtgcattcgg
aaacgcagagttgtacctccatgctaa

DBGET integrated database retrieval system