KEGG   Scleropages formosus (Asian bonytongue): 108929094
Entry
108929094         CDS       T04919                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00230  Purine metabolism
sfm01100  Metabolic pathways
sfm04020  Calcium signaling pathway
sfm04114  Oocyte meiosis
sfm04261  Adrenergic signaling in cardiomyocytes
sfm04270  Vascular smooth muscle contraction
sfm04371  Apelin signaling pathway
sfm04540  Gap junction
sfm04912  GnRH signaling pathway
sfm04914  Progesterone-mediated oocyte maturation
sfm04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108929094 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108929094 (adcy3)
   04020 Calcium signaling pathway
    108929094 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108929094 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108929094 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108929094 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    108929094 (adcy3)
   04916 Melanogenesis
    108929094 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108929094 (adcy3)
   04270 Vascular smooth muscle contraction
    108929094 (adcy3)
Enzymes [BR:sfm01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108929094 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053
Other DBs
NCBI-GeneID: 108929094
NCBI-ProteinID: XP_018598945
LinkDB
Position
1
AA seq 1120 aa
MPRNRAFSEPECSAEYSADCSVTLPSDPGQAVGRTQEVTVRSAGCCMCLPRFMRLTFTPE
SLETLYQTYFRRQRRDTLLVLVVFAVLFDCYVIVMCAVLYTGDKLATVVVASVGLAAHVL
LYLLCFFGLLPDRVSRRVVPYALWVLIAAQIFSYLGLNYSRFHQASDTVGWQAFFTFSFF
LTLPLRLTPIVLISTVSCGIHTLVLGVTIAQQQQENLHGAALARQLLANVVIYLCAISVG
IMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQEGLLLSILPKHIADEMLQGMKKQAS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVEAISYVREKTQTNVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMECLHGEFEVEPGNGGERCE
YLKEKGIETYLVVVPKGPTAKNGINGVKLSVTSSNGNSPVLINTTECNGSIHTACTTPEE
PEELDTRVVNPSFPNPRRRLRLRDLAERVVDAQENEQELNKLLNEALLERETVQALKGKH
TNRLSLRFVDPELETRYSVEKEKQSGAAFSCSCVVLLFTAAMEALIDPQLVVNYVTLVVG
EVLLFILTLCSVAAIFPRMFPKKLVSFSTWIDRTRWARNTWAMAAIFILTMADIVDMLSC
LQPPLRPYNASFGQAFDSSWDGGCAENPKYYSYTAVLALVATTMLVQVSHMVKLTLMLLI
TMATGVVNVYSWRDIYDQYDLVRFKDYSLSQVPSKYQMTVMIFIMMLSFYYFSRHVEKLA
RTLFLWKIEVHNQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGV
MFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDNPQFRCITKIKTIGSTYMAA
SGVTPDTNTNGYNGMKKDEQSDRERWQHLADLADFALAMKVTLMNINYQSFNNFMLRIGL
NKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEDCYVVLKEYGFRFVRRG
PIFVKGKGELLTFFLKGRDKQGSFVNSSSVTLPHQVVDSS
NT seq 3363 nt   +upstreamnt  +downstreamnt
atgcctcggaaccgggccttctcggagcccgaatgctcagcggagtattcggcggactgc
tcggtgactctgccgtctgaccctggccaggccgtgggtcgtacccaggaggtgacggtt
cgcagcgctggctgctgcatgtgcctgccgcggttcatgcggctcaccttcacccctgag
tcgctggagacgctgtaccagacctacttccggcggcagcgacgtgacaccctcctggtt
ctggtggtgttcgcggtgctgtttgactgctacgtcatcgtcatgtgtgcggtgctctac
actggggacaagctggccaccgtggttgtggcatccgtgggccttgccgctcacgtcctg
ctgtacctactttgtttcttcggcctccttcccgaccgtgtgtcccgtcgggtggtgccc
tatgcgctctgggtgctaattgcagcccagatcttctcctacctgggtctcaactactcc
cgcttccaccaggccagtgacaccgtgggctggcaggccttcttcaccttctccttcttc
ctgacactaccactgcgcctcacgcccatcgtcctcatctccaccgtgtcctgcggcatc
cacaccctggtgctgggggtgaccattgcacagcagcagcaggagaacctccatggggca
gcgctggccagacagctcttggccaacgtagtgatttacctgtgtgccatctcggtgggc
atcatgtcatactacatggctgaccgaaaacaccgcaaggccttcctggaggcaaggcag
tccctggaagtgaagctcaacctggaagaacagagtcagcagcaggagggcctgttgctg
tctatcctgcctaagcacattgctgatgagatgttgcaaggcatgaagaagcaagcaagc
caaaaggagatgcaacagttcaacactatgtacatgtaccgccatgagaatgtcagcatc
ctgtttgcagatattgtgggttttacgcagctgtcttcgtcgtgcagtgcacaggaactg
gtcaaactgctgaacgagctgtttgctcgttttgacaagttagccgccaaatatcatcag
ctgagaattaagattctaggagactgttattactgcatctgtgggttgcccgattaccga
gaggaccatgctgcctgctctatcatgatgggcctggccatggtggaagccatctcgtac
gtccgcgagaagacccaaacaaacgtggacatgcgagtgggggtgcacacaggcacagtg
ctggggggcgtgctgggacagaagcgctggcagtatgacgtctggtccacggatgtgacc
gtggccaacaaaatggaggctggaggcatccctgggcgcgttcatatctcccagagcacc
atggaatgcctacatggtgagtttgaggtggagccaggcaatggaggagagcgctgtgag
tacctgaaagagaagggcatcgagacctacctggttgtggtacccaagggcccgacagcc
aagaatggcatcaacggggtgaagctttccgtgacatcatccaacgggaactctccggtg
ctgatcaacactacagaatgcaatgggagcatccacacagcgtgtaccaccccagaggaa
ccggaggagctggacacgcgggtcgtgaacccatcttttccgaacccacggcgtcgcctg
aggctgcgtgacctggctgagagagtggttgatgcacaggagaatgagcaggagctgaac
aaactgctgaatgaagcgctgctggaaagagagactgtgcaggctctgaaggggaagcac
accaaccgcctctccctgcgctttgtggacccggagttggagacgcgctactccgtggag
aaggaaaagcagagcggtgccgccttcagctgctcctgtgtggtactgctgttcacggca
gccatggaagcactcatagacccccagttggtggtgaactacgtgactctagtggtggga
gaagtcttgctatttattcttacactttgctcagtcgcagccatcttccctcgaatgttt
cccaagaagctggtgtctttctcaacgtggatcgaccgcacacgctgggcccgtaacaca
tgggccatggcagccatcttcatccttaccatggcagacattgttgacatgctcagctgc
ctgcagcccccactgcgaccctataatgccagctttggacaggcatttgattcctcttgg
gatgggggctgcgcggagaaccccaagtactacagctatactgctgttctggcccttgtg
gcaaccaccatgctggtccaggtcagtcacatggtcaagctcacgctcatgctgctcatc
accatggcaactggagtggtcaacgtctacagctggagggacatctatgatcagtatgac
cttgtccgcttcaaagactacagcctctctcaggttccttccaagtaccagatgacagtg
atgatcttcatcatgatgctcagcttttactacttctcccgccatgtggagaaactggcg
cggacgctgtttctctggaaaatcgaagtccacaatcagaaggagaaagtctatgagatg
cggcgctggaacgaggcattggtcactaacatgctgcctgagcacgtggccaggcatttc
ctgggctccaagaagagggatgaggagctgtatagccagtcatatgatgagattggggtc
atgtttgcctccatcccaaacttttctgacttctacacagaagagagcatcaacaatgga
ggaatcgagtgcctgagattcctgaatgaaatcatttcagactttgacagtctgctggat
aatccgcagtttcgctgcatcaccaagatcaagaccattggcagtacctacatggcagcg
tctggtgttacacctgatactaataccaatggctacaacggcatgaagaaggacgagcag
tcagacagggagcgctggcagcacttagctgacttggcagacttcgctctggctatgaag
gtcaccctcatgaacatcaactaccagtccttcaacaacttcatgctccgcattggtctc
aacaagggcggcgtgttagcgggagtcatcggggcacggaagccccactacgacatctgg
gggaacactgtcaacgtggctagtcgcatggagtccacgggagtcatgggaaacatccag
gtggtggaggactgctacgtcgtgctgaaggagtacggatttcggtttgtgcggcgaggg
cctatctttgtgaaggggaagggagagctactgaccttcttcctgaaagggcgggacaaa
cagggttctttcgtcaatagctcttctgtcaccctaccccaccaagtggtggacagctct
tga

DBGET integrated database retrieval system