KEGG   Scleropages formosus (Asian bonytongue): 108929504Help
Entry
108929504         CDS       T04919                                 

Gene name
nkx3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sfm03000]
    108929504 (nkx3-1)
Transcription factors [BR:sfm03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    108929504 (nkx3-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 108929504
NCBI-ProteinID: XP_018599570
UniProt: A0A1W4ZFN9
LinkDB All DBs
Position
12
AA seq 221 aa AA seqDB search
MSASVKPLKSFLIQDILSSNESGRVRVKTCGFGPRNEQDRRDDGHSGAVPVQPEDTWISW
SEGETRPRSAVPTTGARGKEERCTATSLDLTRVSAGNVDSAGKQKRSRAAFTHLQVLELE
KKFSMQKYLSAPERARLASSLRLTETQVKIWFQNRRYKTKRKQLASEYVKEIFHKSEGLP
CLGTEEDLIRASFFAAMYKTYQYRPYFYSLHGLGVWKSTLW
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctctgtgaaaccgttgaagtcgtttcttattcaagacatcttgtccagcaac
gaaagcggtcgtgtgagggtgaaaacctgcgggtttggcccccgcaacgagcaggaccgg
cgggatgatggtcactcgggggcggtcccggtgcagccagaggacacgtggatttcgtgg
tccgaaggtgagacccgaccaaggtcggcggtgcctaccaccggtgccaggggaaaagag
gagagatgcacggccacctccctagacctgaccagagtgtccgctggaaacgtggactcc
gcgggcaaacagaagcgctctcgcgctgccttcacgcacctgcaggtgctcgagctggag
aagaagttcagcatgcagaagtacctgtcggcccccgagagagcccgcctggccagcagc
ctgcggctcaccgagactcaggtcaagatctggtttcaaaacagaaggtacaaaacgaaa
cggaagcagctggcatcggagtatgtgaaggagatcttccacaagtctgagggactacct
tgtctaggcaccgaggaggacttgataagggcgtccttctttgccgccatgtacaagacc
taccagtatcgaccttacttctacagcttgcatggactcggagtatggaaatccacatta
tggtga

DBGET integrated database retrieval system