KEGG   Scleropages formosus (Asian bonytongue): 108929569Help
Entry
108929569         CDS       T04919                                 

Gene name
tgm1
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108929569 (tgm1)
Enzymes [BR:sfm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108929569 (tgm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 108929569
NCBI-ProteinID: XP_018599717
UniProt: A0A1W4Z7I1
LinkDB All DBs
Position
Unknown
AA seq 787 aa AA seqDB search
MPVENASVRSRLAVGRFPTVTLGWWEETEPEKEDFVEKQEDKDEEEEEEEGACRRWFRKV
CCSCCRRKTSKDPHEGTDTVETEVPEKTNLPHMDVEEELEELMLTVHSVDLLKSKKGQNR
REHHTDCYHSDNFIIRRGQSFQMWIELSRPFDKNTDKLHLELKLGPLPVVSKGTRVIILL
VEELEGKCWEAKIIDHKDKRIKLSINSPPMALIGQYKLAVVTQSPKGVATSIHDPNNDIF
MLFNPWCEDDLVYMDDEAEKKEYVLNDVGRLYYGTEKQIGARTWNFGQFADGVLEACLYV
LDKTNFPFSGRGNPINVVRVVSAIVNSLDDKGVLEGNWSGDYFGGTAPTAWSGSVDILKK
YHSENGTPVKYGQCWVFSGVTTTVLRCLGIPTRSVTNFNSAHDTDVSLTTDVYFDENMQP
IDELNTDSIWNFHVWNDCWMARPDLPMGMGGWQAVDSTPQETSQGMFCCGPAPINAIRSG
QVFHKYDTPFLFAEVNSDKIYWQRNPDGTFSQIHSEKNTVGHCIITKAVGSHDSNDITLL
YKHEEGSEEERIAVEIACRYGSKPEVYATPTAEDVSLEVIMDGEGPCMGGDAELSITLQN
KSAEPRTATLHSQVTVMYYTGVLKATIKKDSIPVKLSSAEVKTLDWVLQYQDYKDQLVDQ
AALMLTLSGRVSETQQVLATQYSFRLRTPDLHITPVGDAVVGKEMEAKISFTNPLPRILK
NVTVRVEGLGLQSVRQIPVGDVGSHATVTLTECFTPMLPGPRKLLASLDCRQLTQVHGVA
DIIVREN
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtggagaatgcatcagtgagaagcaggttggctgtgggccgcttcccaaccgta
accctgggctggtgggaggagacggagcccgagaaagaggactttgttgaaaagcaagag
gataaggatgaggaggaggaggaggaggaaggtgcctgccgtcgctggttccgcaaggtg
tgctgctcctgctgtcgacggaagaccagcaaagatccacatgaaggcacggacacggtt
gaaactgaagtcccggagaagacaaacctccctcatatggatgttgaggaagagctggag
gagttgatgctgactgttcattcagtggacttgctaaagagcaagaagggacagaaccga
cgcgagcatcatacagactgttaccacagtgacaacttcatcatccgacgtgggcagagc
ttccagatgtggattgagctctccaggccttttgacaaaaacaccgacaaacttcacctg
gagctcaaattgggacccctcccagtggtatcaaaaggcacacgtgtcataattttgttg
gttgaagagctagagggcaagtgctgggaagccaaaatcattgaccacaaagacaaaagg
attaagctgtccatcaactcccctcccatggctctgattggccagtacaaacttgctgtg
gtaactcaaagtccaaaaggtgtggccacatcaatccatgaccccaacaatgacatcttc
atgctgttcaacccttggtgtgaagatgacttggtgtacatggacgatgaggcggaaaag
aaggagtacgtcttgaatgatgttggcaggctgtattatggtacagagaaacagatcggt
gcccgaacatggaattttggccagtttgcagacggagtcctcgaagcctgtctctatgtc
ttggataagactaatttcccattttcgggtcgtggaaatcctatcaatgtggttcgggtc
gtatctgccattgtcaattcccttgatgacaagggagttctggaggggaactggtctggg
gattactttggtgggactgctcctacagcctggagcggcagcgttgacatcctgaagaag
taccactcagagaatggtacacctgtcaaatatggccagtgctgggtcttctctggggtc
accaccacggtgctgaggtgtctgggcatccccaccagaagtgtcaccaacttcaactct
gcacacgacaccgacgtctccttgacaacggatgtgtattttgatgagaacatgcagccc
attgatgaactcaataccgactctatctggaacttccatgtgtggaacgattgctggatg
gcgcgccctgacctgcctatggggatggggggctggcaggctgttgactccactccccag
gagaccagccagggcatgttctgctgtggccccgcccccatcaatgctatccgctcgggg
caggtgttccacaagtatgacacacccttcctctttgctgaggtgaacagtgacaaaatt
tactggcagaggaacccagacggcacattcagccagatccacagtgagaagaatacggtg
gggcactgcatcatcaccaaggctgttggctctcatgactccaatgacatcacactgctc
tacaaacatgaagagggctcagaggaggaacgcattgcagtggagatcgcctgtcgctat
ggcagcaagccagaggtatacgccaccccaactgctgaagatgtgtccttggaggttatc
atggatggggaggggccatgcatgggaggagatgctgagctgtccatcacactccaaaac
aagagtgctgaaccacgcaccgccactctacacagtcaagtgacagtcatgtactataca
ggtgtgctcaaggccaccatcaagaaggacagcatccctgtcaaacttagctctgctgaa
gtgaagaccctggactgggtgctgcagtaccaggactacaaagaccaactggtggaccag
gctgcattgatgctgacattatctggtcgagtcagtgagacccaacaagttttggcaacg
caatacagcttccgcctccgaacccccgatctccatattacacctgtaggggatgctgtg
gttgggaaagagatggaggctaagatctccttcacaaacccactgccgcgcatcctgaag
aacgtcacggtccgtgtggagggcctggggctccagagcgttcgacagatccccgtgggg
gacgtgggcagccacgccacggtgacgctgacggagtgcttcactcccatgctgcccggg
cccaggaagctgttggcttccctcgactgccgccagctcacccaggtccatggggtggcc
gacatcatcgtgcgggagaactga

DBGET integrated database retrieval system