KEGG   Scleropages formosus (Asian bonytongue): 108929711
Entry
108929711         CDS       T04919                                 

Definition
(RefSeq) erythropoietin-like isoform X1
  KO
K05437  erythropoietin
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108929711
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sfm04052]
    108929711
Cytokines and growth factors [BR:sfm04052]
 Cytokines
  CSF and other factors
   108929711
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 108929711
NCBI-ProteinID: XP_018599926
LinkDB
Position
13
AA seq 190 aa
MRDYVDSDMETARFVAVLLMVLQWTRLGLPSPLRPICDPRVLDRFIKEARDTEFAMRSCS
EGCSLAEPLSVPLTSVDFAIWEKGDPQKQAQEVQSGLWLLAQAISAVRVSITSTALHSLL
DNSHSNIHSIGQVIRSLNFPEYTPPADGTVHEDTWRVSSTLELFRVHTNFLRGKVRLLLS
HAPACRRDST
NT seq 573 nt   +upstreamnt  +downstreamnt
atgagggattatgtggattccgatatggagacagcccgatttgtcgctgtgctgttgatg
gttctgcagtggacccgactgggtctgccctccccactgagaccaatctgcgacccaagg
gtgctagatcgcttcatcaaggaagcacgagacacagagttcgccatgaggagctgcagt
gaaggatgcagtctcgctgagcctctttctgttccccttaccagcgtcgattttgccatc
tgggagaaaggagatccacagaagcaggctcaggaggtacagtctgggctctggcttctt
gctcaggcgatcagtgcggtgcgggtatctatcacaagcacagcactacacagcctcctc
gataacagtcacagcaacatccacagcattgggcaggtgatccgcagccttaattttccg
gaatatacccctcctgcagatggcacagttcatgaggatacctggcgtgtctcctctaca
ttggaattattccgcgtccacaccaactttctgcgtggtaaagtccgcctcctgctgtct
catgccccagcttgtcgccgtgactcgacatga

DBGET integrated database retrieval system