KEGG   Scleropages formosus (Asian bonytongue): 108931332
Entry
108931332         CDS       T04919                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04010  MAPK signaling pathway
sfm04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108931332 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    108931332 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sfm04052]
    108931332 (kitlg)
Cytokines and growth factors [BR:sfm04052]
 Growth factors
  Growth factors (RTK binding)
   108931332 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 108931332
NCBI-ProteinID: XP_018602558
LinkDB
Position
2
AA seq 271 aa
MKKAKISISVCVHFLLCATFGTSSEVRSCIADDLERISLLKQNIPKDYKITVRHIPKEVS
GMCWVVLNVFHLEESLKDLAQKFGNISSNRDNIDIYVQTLQDVRFKIINKGEIDLESTME
EFQCHYREERWPTEEYFDYVKDLLNAANSKNESRGCESPLCPSATTEANMSGEHTEPHAM
VGCNELVPNCSARAEHQYLPKIVEKSLLWMLIIPLAMGLLCLVWKISCRRRREEPEPNPD
SGHVLTDIEGKAAPLHGQLSGHKIRLSMEMV
NT seq 816 nt   +upstreamnt  +downstreamnt
atgaagaaggcaaaaatttctataagtgtttgtgtccatttcttgctgtgcgccactttt
ggaacatccagtgaagttagaagttgtatagcagatgatcttgagagaatctcattgttg
aaacaaaatatcccaaaagattacaagatcactgtgcgtcacattcctaaagaagtgagt
ggtatgtgttgggttgtgcttaatgtgtttcatctggaggaaagcttgaaagatctggcc
caaaaatttggaaacatttcctccaacagagacaacattgatatatacgtgcaaacactg
caagatgttcgctttaaaattattaataaaggtgaaattgacctggagtcaacgatggag
gaatttcagtgccattacagagaggagagatggccaacggaagagtattttgactacgtg
aaagaccttttaaatgctgccaattcaaaaaatgagagcagaggatgtgaatctcccctc
tgcccatcagcaacaacagaggcgaacatgtcaggtgaacacacagagccccatgccatg
gtgggctgtaatgagctggtgccaaactgcagcgctagagcagaacaccagtatctccca
aagattgtggagaaaagccttctgtggatgctcataatcccgctggccatggggcttctc
tgtttagtctggaagatcagctgcagaaggagaagggaggagcctgagccgaaccctgac
agcgggcacgtcctcactgatatcgaagggaaagccgcgcctttacatggccaactgtca
gggcataagataagactcagcatggaaatggtgtaa

DBGET integrated database retrieval system