KEGG   Scleropages formosus (Asian bonytongue): 108931519
Entry
108931519         CDS       T04919                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm04012  ErbB signaling pathway
sfm04068  FoxO signaling pathway
sfm04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108931519
   04068 FoxO signaling pathway
    108931519
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108931519
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 108931519
NCBI-ProteinID: XP_018602803
LinkDB
Position
2
AA seq 193 aa
MSNVRLSNGSPPLERMDARLSEISKPATCRVLFGVPDRQELQREFRGHLRDMEETSRAKW
NFEFAAHKPLPPGRYEWKAVDAKDVPGFYSRPHRTPDGTVDLNGNHSCAVVGGSSGAETP
GYRRSDGRTEGSESPGFNRDQSAVQRKRAASDESSCQNKRSKTGSDEGSSQSNSDRSSPT
EHTPRKRSPKEAQ
NT seq 582 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgactgtcgaatggcagccctccgctggagaggatggatgcgcgactg
tcggagatctccaaacccgctacctgccgggtgctgttcggggtgccggaccgccaagag
ttacagagggagttcaggggacatctgcgggatatggaagagacgtcccgcgccaaatgg
aactttgaattcgcggcacataagccgctcccacccgggcggtacgaatggaaagccgtg
gatgctaaagatgtgccaggcttctacagcagaccgcaccgaacgcccgatggcaccgtg
gatctaaacggaaaccacagctgtgcggtggtgggggggtcctccggtgcggagaccccc
gggtacaggcgctctgacgggagaacggagggctcggagagtccggggttcaacagggac
cagtccgcggtgcagaggaaaagagcagcgagcgacgagtcctcgtgtcagaataaaagg
tccaaaacgggttcggatgaaggcagcagtcagtcgaactcggatcgctccagtccgacc
gaacacacacccaggaaacgcagtccaaaagaagcgcagtga

DBGET integrated database retrieval system