KEGG   Scleropages formosus (Asian bonytongue): 108931975Help
Entry
108931975         CDS       T04919                                 

Gene name
mcm10
Definition
(RefSeq) protein MCM10 homolog
  KO
K10736  minichromosome maintenance protein 10
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108931975 (mcm10)
DNA replication proteins [BR:sfm03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   Other initiation factors
    108931975 (mcm10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcm10 zf-primase YokU
Motif
Other DBs
NCBI-GeneID: 108931975
NCBI-ProteinID: XP_018603611
UniProt: A0A1W4ZSW2
LinkDB All DBs
Position
5
AA seq 792 aa AA seqDB search
MEGEDDLDILTCLLAENHTQVSGLESFSGSDEDQGVNGGVHAERREHCPGFSVDSDSMKD
QGSELVQTLDQKASDNRGKFKADLEAELQFMQEHMQKLQQQLEASYYAKAAAQLPQDQSS
MQEAPRHERATQSKGQAQQSVCSKLSQSTGKASALQHSLPSTSTVEVALTTLKQATPYQH
SLQDVAVEKFSGLRIRKPLVSSIEMERKMENRRLIRLSQLPERLAREKLEESDWVTFAVV
VSKITPQSNSSGKTFSIWKLNDLRDLDVYISLFLFGEVHKEHWKTDPGTLIGLLNPNPMK
PKEGSNTVCLSVDHPQKILVMGMAQDFGTCKATTKNGNPCSQLVNLYECQVCQYHMKAQY
KRMSSKRMDLQSSFSGKVPRKARGKAAIGLKERLCHSGFHYGGVSSVACSASLSIPLKKN
PTQTSLRNLVVRGSEQIVSKAKQLAMNSNDISGCSDDFKNLLSLPTPGALNLKRHLIQSN
SSGLPGLTGTGIQSISAAQLIKQQKHQLLESRHRRAEEAQHRFLQTVPVTQMPKGVNLTP
KQQHLTPKLGRGFSESEDILFFDHVSSPAAVSLSAAKLAALKKLQAKGAVISKEDPNAVK
RKRPSISDIAGRVEKNLASHQCDSEVDLGEPELKRRREYLEYLQSDDFQQILNAKSKHLE
SLQAAEVQIQKEYFDPLVQKEQLEEKMRNIQEMKCRAVTCKTCKYTYFKPLDRCVQEKHE
YSWHNAVKRFFKCPCGQRSIALDKLPHKHCSNCGLFKWERDGMIKEKSGPKIGGELLLPR
GEEHPKFLMSMK
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtgaagatgacttggacatcttgacctgcctcttggcagagaaccacacgcag
gtttcaggtctcgagtccttcagcggcagtgatgaggaccaaggtgtaaatggaggagta
cacgctgagagaagagaacactgccctggcttctctgtggattcagatagcatgaaggac
cagggcagtgagctagtccagaccttagaccaaaaagccagtgataatcggggcaaattt
aaagcagatttagaagctgagctgcagttcatgcaagagcacatgcagaagttgcaacag
cagttggaggcttcttactatgcgaaagcagctgcccagttgccacaagatcagtcttcc
atgcaggaagccccaagacatgagcgagccacacagtccaagggccaggcacaacagagt
gtgtgcagcaagctgtctcagtcaacagggaaagcaagtgccctccagcattccctgcct
tcaacatctacagtggaggtggcactgaccactctaaagcaagctacaccctatcaacat
tctttacaggatgtagctgtagaaaagttttctggcctcaggatcaggaagcccctcgtg
tcttccattgaaatggagagaaagatggagaaccgcagactgatacggctgtcacagttg
cctgagaggctcgctcgagagaagttggaggagagcgactgggtcacatttgctgtagtt
gttagcaaaatcaccccacagagtaacagcagtggcaagactttcagtatttggaagctg
aatgatctcagagacctcgacgtatatatatccctcttcctgtttggggaggtacacaaa
gagcactggaagactgatccaggcactttgattggcctccttaacccaaatccaatgaag
cccaaggaaggttctaatacggtatgtctgtcagtagatcatccacagaagatcctggtt
atgggtatggcccaagattttggcacctgtaaagctaccacgaaaaatggaaacccctgc
agccagctggttaatctgtatgagtgccaggtttgccagtaccatatgaaggcacaatac
aagagaatgagctccaaacggatggatttgcaatccagtttttctgggaaggtaccaaga
aaggccagaggaaaggcagccattgggctgaaggagcgtctgtgtcacagcggatttcat
tatgggggtgtgtcctcagtggcatgttctgcatctctgtccattccacttaaaaagaat
ccaacgcagacatctttgaggaatctggttgtgaggggatcagagcagatagtcagcaaa
gcaaagcaacttgcaatgaattcaaatgacatctctggttgctctgatgacttcaaaaat
ctgctgtcgttgccaactccaggtgccctcaacctgaaaagacacttgatacagagcaac
tcctcgggtttgcctggactaacaggtacagggattcagtccatctctgctgctcagctc
atcaaacaacagaaacatcagctgttggagtccaggcataggagggcagaggaagcccaa
cacaggttcctacagactgttccggtgacccagatgccaaaaggagttaatctaacccca
aaacagcaacatctcacacccaaactggggcgtggtttcagtgagagtgaggatattctg
ttttttgaccacgtgtcctcccctgcggcagtgagcctgtctgctgctaagttagcggcc
ttgaagaagctgcaggcaaagggagcggtcatctcaaaggaagacccaaatgctgttaag
cgcaagaggccaagcatcagtgacattgctggaagagtggaaaagaaccttgcctcgcat
caatgtgactcggaggtggacttgggtgaaccagagctgaagaggcgtcgggagtacctg
gaatatttgcagtctgatgattttcagcaaatcctcaatgccaagtccaaacatttagag
tcactacaagcggcagaggttcagatacagaaagagtactttgaccctcttgtacagaaa
gagcagcttgaggagaagatgaggaatatccaggagatgaaatgcagagctgttacttgt
aagacgtgtaagtacacctacttcaagcccctggacaggtgtgtgcaagagaagcatgag
tacagctggcacaatgctgttaaacgcttcttcaagtgtccttgtggacaaaggtcaatt
gcgttggacaaactgccacacaagcactgcagcaactgtggccttttcaagtgggagaga
gacggcatgatcaaagagaaatctggcccgaagattggtggtgagctgctcttaccacgg
ggagaggagcatcctaaatttctcatgagtatgaagtga

DBGET integrated database retrieval system