KEGG   Scleropages formosus (Asian bonytongue): 108932092Help
Entry
108932092         CDS       T04919                                 

Definition
(RefSeq) transmembrane protease serine 4-like
  KO
K09635  transmembrane protease serine 4 [EC:3.4.21.-]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sfm01002]
    108932092
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     108932092
Peptidases [BR:sfm01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108932092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR SRCR DUF1986 Ldl_recept_a Trypsin_2 DUF4951
Motif
Other DBs
NCBI-GeneID: 108932092
NCBI-ProteinID: XP_018603799
UniProt: A0A1W4ZJB4
LinkDB All DBs
Position
Unknown
AA seq 465 aa AA seqDB search
MTRNAMRTETRVPVESTVPLNPGTGQASRSGKHRKAMAAPKAPKQNVARWKGILITVALV
LLVLGILVVAGYFIKELIDSKYFFCVKSFKFIPLNLACNGHADCIGGEDEQTCVSNLTVQ
TPFPVRLVSTQNVLQVYQNASGWRTVCADQWSQDYTRITCQQLGYTANPSSVNVTIQSLP
QSLTTSFSQVASSKPQSVLLNFNVINSPRCSSGLVVSLTCSDCGERPPQDRIVGGVDARI
EDWPWQVSLQLNGQHTCGGSLVSLRWVVSAAHCFASTTKELSRWRVVYGKTYVTILGGST
VDKIIMNGNYDPHENDFDIAMMRLSQPITVTAVTHPVCLPPRDLSLENGAPLVVTGWGYL
HENANAVSTTLQKADVTLIGQRTCSSTAVYGAAITPRMLCAGFMDGKVDACQGDSGGPLV
YLSDRWQQVGVVSWGVGCARNQKPGVYSNVDSMLDWIYTVMEKNS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaccagaaacgcaatgaggacggagacgcgggtcccagtagagagcactgtgcccctc
aaccctggaacgggtcaagcctctcggtctggaaagcacaggaaggcgatggcggcaccc
aaggccccgaaacagaatgtggctcgatggaaaggcatcctcatcacggtagccttggtg
ctgctcgtactgggcatactggtggtggcgggatacttcatcaaggagctcatcgacagc
aagtacttcttctgtgtcaagtcattcaagttcatccccctgaatctggcctgcaatggc
catgcggactgcattgggggagaggacgagcagacctgtgtgtccaacctgactgtccaa
actcctttcccagtccgcctggtgtccacccaaaacgttctgcaggtgtatcagaacgcc
tctggctggaggacggtgtgcgcagaccagtggtcccaggattatacgcggatcacctgt
cagcagctgggatatacagctaatcccagcagcgtcaatgtaaccatccagagcctacca
cagtccctgacgacatccttcagtcaggttgcttccagcaaacctcagtcagttttactg
aacttcaatgtcattaacagcccacgctgctcctccggtttggtggtttcgctcacctgc
tcagactgcggagagcggccccctcaggaccgcatcgtgggtggggttgatgcaagaatc
gaggactggccctggcaggtcagcctgcagttgaacggccagcacacctgcgggggcagt
ctggtgtctctgcgttgggtggtctcggcggcacactgctttgccagcactaccaaggaa
ctgagtcgctggcgcgtggtctatgggaagacctatgtgaccatcttggggggctcaaca
gtggacaagattatcatgaacgggaattacgacccccacgagaatgattttgacattgcc
atgatgcggctgtctcagcccattaccgtgacagctgtcactcatccagtctgcctgccc
ccccgtgacctgtccctggaaaatggggcacctctggttgtaaccggctggggatacctc
catgaaaatgccaacgcagtgtccactactctgcagaaggctgatgtgaccctcataggt
cagagaacatgtagtagcactgctgtgtatggtgcagccatcactcccaggatgctttgc
gctggcttcatggatggcaaagttgatgcttgtcagggggacagcggaggcccgttggtg
tacctgtctgaccgctggcagcaggtgggcgtggtgagttggggcgtgggctgtgcacgc
aaccagaagccgggagtctactccaatgtggactccatgctcgactggatctacacagtc
atggagaaaaattcctga

DBGET integrated database retrieval system