KEGG   Scleropages formosus (Asian bonytongue): 108932266
Entry
108932266         CDS       T04919                                 

Gene name
nos2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00220  Arginine biosynthesis
sfm00330  Arginine and proline metabolism
sfm01100  Metabolic pathways
sfm04020  Calcium signaling pathway
sfm04146  Peroxisome
sfm04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108932266 (nos2)
   00330 Arginine and proline metabolism
    108932266 (nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108932266 (nos2)
   04020 Calcium signaling pathway
    108932266 (nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108932266 (nos2)
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     108932266 (nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 108932266
NCBI-ProteinID: XP_018604029
LinkDB
Position
10
AA seq 1069 aa
MKVLQGKRAGKEAILVHNLCDGSTLEDTLHHRAVKSQPCRPKVCQSSVAMPKSLVAEPSR
NPTPSQDLLVQAVEFINQYYNSLKTPKTEEHLARVEAVAAEIDATGTYQLTEEELAFGAK
HAWRNAARCIGRIQWANLHVFDARKCRTTRDMFRFLCGHMRFATNGGNLRSAITIFPQRL
DRKRDFRVWNSQLVRYAGYRMPDGSIRGDPANVEFAELCAQLGWTPRYGRFDVLPLVLQA
NGGDPEIFEIPPELVLEVPMEHPQYEWFQELQLRWYALPAVSNMLLEMGGLEFPGCPFNG
WYMGTEIGVRDLCDSQRYNILEQVGRRMGLEIHNLSSLWKDQALVAINVAVIHSFQKHNV
TITDHHSAAESFIRHMQAEFKLRGGCPADWTWLVPPMSGSLTPVFHQEMVNYVLSPYFYY
QPDPWLTHVWRDKKRRPRKRNVSFGGVARAALFCSLLMHQAMTARVRSTVLYATETGKSQ
ALAKKLNSMLNCAFSSRVLCMEDYNPGDLEKEDFLAVVTSTFGNGDAPENGKTFRRHLFA
LKHLRNKFRYCVFGLGSRVYPRFCAFAHEVDAKLEDLGGRRVTPTGEGDELDGQEEAFSA
WAGAAFKEACREFGIHNLLTVQLSGTERPTHTWDPSRYRVQPESFTQDRITALSSIHSKA
VLPMKLKRRQNLNSSKSSRATILVVLESEGDVEGVRCLPGEHIGVFPGNPARLVTGILKH
LLDAPPTNQSLRLEYHFDYGLDGDKSWQTDKHIPACTLSQALTYFLDITAPPVQSLLYKL
SQLAGQEGHRQQLLTLARDSKQYCAWKEFHRPTFLDVLEEFPSLAITTTFLLSQLPMLKP
RLYSMSSSPDLHPRELHLTVAVVKYQTQDGHGPLHHGVCSTWMNTIKEGDMVPCFIHRSS
GFHLPPESSIPAILVGAGSGIAPFRSFWQQRLHDMKIKGVMCAAMTLVFGCQSSNKDHLY
SEETLEMKRQGVLKNVLPAYSRQPGQPKVYVQDVLRKQLAGEVVRILHQSSGHLYVCGNV
EMVHDVACAVQEILGRELDMSSAQAREYLIQLKTEKRFHEDIFGVTFQK
NT seq 3210 nt   +upstreamnt  +downstreamnt
atgaaagtgctgcaagggaagagagctggcaaggaggcaatattggtgcacaacctgtgt
gatggctccacccttgaagacaccttgcatcacagagctgtcaagagccagccttgccgt
ccaaaggtgtgtcagagctctgttgcgatgcccaagtcgctggtggcggagcccagcaga
aacccaaccccgtcgcaggaccttcttgtgcaggctgtcgagttcatcaatcaatactac
aactctctgaaaaccccgaaaactgaagagcaccttgctcgagtggaggctgtcgccgcg
gagatagacgccacgggaacctatcagctcacggaggaggagctggcgttcggagccaaa
cacgcctggcggaatgcagcacgatgcattggcaggatccagtgggcgaacttacacgtg
ttcgatgcccgaaagtgccggaccacccgggacatgtttcggttcctgtgcggccacatg
cggtttgccacgaatgggggaaacctgaggtcggccattaccattttcccccaaaggctg
gataggaaacgtgacttccgggtgtggaacagccagctggtgcgatacgctgggtatcgg
atgccggatgggagcatccggggggacccggctaacgtggagttcgcagagctctgcgcg
cagctgggatggacaccgagatacggccgctttgatgtgctaccactggtcctgcaggcc
aacggaggcgatcctgaaatctttgaaattcccccagagctcgttctagaggtcccgatg
gagcatcctcagtacgagtggttccaggaactgcagctcagatggtatgccctccctgcg
gtctccaacatgctgctggaaatgggcggcctggagttccccggctgccccttcaacggc
tggtatatgggaacggagatcggcgtgagggacttgtgtgactcccagcgctacaacatc
ctggagcaagttggtcgcaggatggggctggagatacacaatctgtcttcgctgtggaag
gaccaggcgctggtggccatcaacgtcgcggtaatccacagcttccagaagcacaacgtg
accataacggaccaccactcagcagctgaatccttcataaggcacatgcaggctgagttt
aagcttcggggaggttgtccagcagattggacctggctggtgccacctatgtccggctcc
ctcacacctgttttccaccaggagatggtcaactatgtcctctccccatacttttattat
cagccagacccctggttgacccatgtttggagagacaagaagcggagaccaaggaaaaga
aatgtttccttcggaggggtagccagggcggcactgttctgctccttgctgatgcaccag
gccatgactgcgagggtgcgaagcacagtgctatatgccacggagactggcaaatcacag
gctttggccaaaaaactcaactccatgctgaattgcgcattcagctccagggtcctgtgc
atggaggactacaaccctggtgacctggagaaggaggacttcctggcggtggtaaccagc
accttcggcaatggagacgccccggagaacgggaagactttcaggaggcacctttttgcc
ttaaagcacctaagaaacaaattcaggtattgcgtgtttgggctgggctcgcgtgtgtat
ccacggttctgcgccttcgcccacgaggtggatgccaagctggaagaccttggtggcagg
cgtgtgactcccaccggcgaaggcgatgagctggacgggcaagaagaggctttctctgcc
tgggcaggagctgccttcaaggaggcttgccgggagtttggaatccacaacctgctcacg
gtccagctctcggggacagagcggccgacacacacctgggacccctctaggtacagagtg
caacctgagagtttcacgcaggatcgcatcacagccctctcgagtatacactccaaagca
gttctccctatgaagctaaagaggaggcagaatttgaatagctcaaagtcaagtcgtgcc
actatccttgtggtgctggagagcgaaggcgatgtggagggcgtgcgatgcctcccgggg
gagcacatcggggtctttcccggtaacccggcacggctggtcaccggaatcctcaagcac
ctcctagatgcgcccccaaccaatcagagccttcgcttggagtaccactttgactacggc
ctggatggggataagagctggcagacggacaaacatatcccagcatgcactctgtcccaa
gcactgacctacttcctggatattaccgcaccccccgtgcagagtcttctttacaaactg
tctcagctggccggccaggagggtcaccggcagcagctgctcacattagctcgggactct
aagcagtactgcgcgtggaaggaatttcacagacccaccttcttggatgttctggaagag
ttcccttctttggcgatcacgacaaccttcctcctcagccagctacccatgctgaagccc
cggctctactccatgagctcctctcctgacctccatccccgagagctccacctcaccgtg
gctgtggtcaaatatcaaacccaagacggacatggtcctctacaccatggggtctgcagc
acctggatgaacaccatcaaggagggagacatggtgccctgcttcatacacaggtccagt
ggcttccaccttccaccagagtcctccattccagccatcctggttggggcaggcagtggc
attgccccctttaggagcttttggcaacaacggctacatgacatgaaaatcaaaggggtg
atgtgtgccgccatgaccctggtgtttggctgccagagttccaacaaagaccacctttac
agcgaggagaccctggagatgaagcggcagggagtgctgaagaatgttcttccagcatat
tctcgccagcctgggcaaccaaaagtctacgtccaggatgtcctgaggaaacagctggca
ggtgaggtggtgagaatcctgcatcaaagctcggggcatttgtacgtctgcgggaatgtg
gaaatggtgcacgatgtggcgtgcgcggtccaagagatcttgggccgggagctggatatg
agctctgcccaggctcgagaatacctgatccagctcaagactgagaagagattccatgaa
gatatatttggagtaacatttcagaaataa

DBGET integrated database retrieval system