KEGG   Scleropages formosus (Asian bonytongue): 108932299Help
Entry
108932299         CDS       T04919                                 

Definition
(RefSeq) transmembrane protease serine 2-like isoform X1
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sfm01002]
    108932299
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     108932299
Peptidases [BR:sfm01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108932299
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 Ldl_recept_a Trypsin_2 SRCR Prokineticin
Motif
Other DBs
NCBI-GeneID: 108932299
NCBI-ProteinID: XP_018604076
UniProt: A0A1W4ZU83
LinkDB All DBs
Position
Unknown
AA seq 495 aa AA seqDB search
MFVSWLGYSSHVTLWILVCFSPQDSSPYYGFQQEGGRPPPYNPAIGGYPPFTLQYPSNLP
QYSPQAIPIHNIAAPELLEPTLNRTGQKRKYMCIVTSVVCVVLLLAVVAILLWYFLYFRC
VFGMSCGDGGCISVSQWCNGVKDCPLGQDETQCFRLYGSSSVLQAYSTQSRSWKMVCAAG
WNDAFGRAACEQIGYDRQSYVGYEMTTVNQDLDGYLTLLPQATPQNLLHSCLVLYTTCSV
GRLVALHCIDCGSRVISDSRIVGGQVAKPGAWPWQVSLQVQREHLCGGSIITPYWIVTAA
HCVEGISSPSNWTVYAGRLSLSDMYRSVGNSVSLIVSNKYNSNTKNNDIALMKLRNPLTM
SNVVKPVCLPNAGLNFTAPRQCWVSGWGATYSGGSVSQVLKEVQVSLIDRSTCNSPSVYS
GEITDTMICAGRLQGGVDSCQGDSGGPLVTEENHLWWLVGDTSWGYGCAVRNKPGVYGNV
TVFLRWIYEQMQKYK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgtcatggcttggttattcatctcatgtcaccttgtggatactggtgtgtttt
tccccacaggactcgagcccatactatggtttccagcaggagggggggcggcctcctcct
tataaccctgccataggggggtatcctccgttcacgctgcagtacccgtccaacttgccc
cagtactccccccaagccatccccatccacaatattgccgcaccggagctgttagagccc
acccttaaccgcacagggcaaaagaggaaatacatgtgtattgtgacatctgttgtctgt
gttgttcttctcctggccgtggtcgcgatcctactgtggtattttctctacttcaggtgt
gtttttggcatgtcctgtggagacggtggttgcatcagtgtgtcccagtggtgtaatggt
gtgaaggactgccctttggggcaggatgaaacccagtgctttcggctctatggttccagc
tctgttctgcaggcgtattcaacacaaagcagatcgtggaagatggtgtgtgctgctgga
tggaatgacgcctttgggagagcagcatgtgaacagattggatatgacaggcagtcctat
gtaggctatgagatgaccacggtaaaccaggacctggatggctacttgacactgttgcct
caggcgactccacagaaccttctacacagttgcctcgtcctctacacaacatgttcagtt
ggcagacttgtagcactgcattgcattgactgtgggtcccgggttatctcagattcccgc
attgtgggtggacaggtggccaagccaggggcgtggccatggcaggtcagcctgcaggtc
cagagggagcacttgtgtggcggctccatcatcaccccttactggatcgtgacagcggca
cactgtgtggaagggatttcgagcccctccaactggactgtctatgctggccgtctctcc
ctgtctgacatgtatcgctctgttgggaactcggtatctctcatcgtctccaacaagtac
aacagcaacacaaagaacaatgacattgctctgatgaagctaaggaacccacttacaatg
tcaaatgttgtcaaacccgtgtgtctacccaatgctggcctcaactttacggctcctcgg
caatgttgggtttctggatggggggcaacttatagtggaggatcagtgtcccaggttctg
aaggaggtccaggtctcactgattgacaggagcacctgcaacagtccatctgtgtacagt
ggcgagatcacagacacaatgatctgtgctggaaggttacagggtggagttgattcctgc
cagggtgatagcgggggacccctggtcacagaggagaatcatctctggtggctggtgggg
gacacaagctggggttatggctgtgctgtgaggaacaagcctggagtgtacggcaatgtg
actgttttcctccgctggatctacgaacagatgcagaaatacaaatga

DBGET integrated database retrieval system