KEGG   Scleropages formosus (Asian bonytongue): 108932554
Entry
108932554         CDS       T04919                                 

Gene name
ung
Definition
(RefSeq) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108932554 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108932554 (ung)
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     108932554 (ung)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     108932554 (ung)
 Prokaryotic type
     108932554 (ung)
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-GeneID: 108932554
NCBI-ProteinID: XP_018604530
LinkDB
Position
19
AA seq 290 aa
MIGQKTINNFFSPVAKKRTSSRRNEGDASDSEAPPKKVKVEVGRESATCQSNPSSRPPLQ
GLRYNNVPHGFGESWRKALSAEFDKPYFTNVMSFVSEERKKHSVYPPTHQVFTWTQMCPI
RDVKVVILGQDPYHGPNQAHGLCFSVQKSVPSPPSLVNMYKELATDVEGFKHPGHGDLTG
WAKQGVLLLNAVLTVRAHQANSHKDKGWEKFTDSVVQWLSTNLHGLVFMLWGSYAQKKGA
TIDRRRHHVLQGVHPSPLSAHRGFFGCKHFSKTNELLTRSGKRPIDWKAL
NT seq 873 nt   +upstreamnt  +downstreamnt
atgattggacagaaaactataaacaatttcttttcccctgtggctaagaaaaggacatct
tctcggcgaaacgaaggagatgcaagtgacagcgaagctccaccaaagaaggtcaaagtg
gaagtcggcagggagtcggccacctgtcaatcaaatcccagttcccgcccaccgttgcaa
gggctgcgatacaacaacgtaccgcatggcttcggggagagctggagaaaggcgctgagt
gcagaatttgacaagccttatttcacaaatgtgatgtccttcgtttcagaagaaaggaag
aagcacagtgtctatccccccactcaccaggtttttacctggacgcagatgtgtcccatc
agagatgtgaaagtggtcatactcggtcaagacccataccatggtcccaaccaggcacat
gggctgtgttttagtgtgcagaagtctgttccatccccaccaagtttggtgaacatgtac
aaggaattggctacagatgttgaaggcttcaagcaccctggacatggtgatctcacaggg
tgggccaaacaaggtgtcctgcttctcaacgcagtgctgacagttcgagcacatcaggca
aactcccacaaagataagggctgggagaagttcactgattctgtagtgcagtggctcagc
accaatctccatggtctggtctttatgctgtgggggtcctatgcccagaagaagggtgct
accattgacaggagacgacaccatgttctgcagggggttcacccttcacccctgtctgct
caccgtggtttcttcggatgcaaacacttctcaaagaccaatgagctgctaacaagatct
ggaaaaagaccgatagactggaaggccctctga

KEGG   Scleropages formosus (Asian bonytongue): 108933863
Entry
108933863         CDS       T04919                                 

Definition
(RefSeq) uracil-DNA glycosylase-like
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108933863
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108933863
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     108933863
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     108933863
 Prokaryotic type
     108933863
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-GeneID: 108933863
NCBI-ProteinID: XP_018606758
LinkDB
Position
6
AA seq 301 aa
MIGQKTIHSFFSPVVKKRLSDGNAEGETKSKDDDVSGLKKLRCGSDAPPGSPPLSPEQLQ
RIEQNKQAALERLAARNVPPGFGESWRRALSAEFGKPYFSKLMSYVAGERSRHTVYPPPD
QVFSWTQMCAIQDVKVVILGQDPYHNPSQAHGLCFSVQKPVSPPPSLENMYKELSVDIEG
FQHPGHGDLTGWAKQGVLLLNAVLTVRAHQANSHRDQGWETFTDAVVLWLNANLDGLVFM
LWGAYAQRKGDVINRKRHHVLQAAHPSPFSVHRGFFGCRHFSKTNELLQRSGKKPIDWAA
L
NT seq 906 nt   +upstreamnt  +downstreamnt
atgattggccagaagacaatccactctttcttttcccctgtggtgaaaaagaggctttcg
gacgggaatgctgagggagaaaccaagtcaaaggatgatgacgtgtccgggctgaagaag
ctgagatgcggcagcgacgcaccaccgggttcccctccgctgagtcccgagcagctgcag
cggatcgagcagaacaagcaggccgcgctggagagactggctgcccgcaatgtgccgccg
gggttcggggagagctggaggagagcgctgagcgccgagttcgggaagccctacttctcc
aagctcatgtcctatgtggcgggagagaggagtcgacacaccgtctacccgcctcccgat
caagtgttttcctggactcagatgtgtgccatccaggatgtgaaggtggttattttgggt
caggacccctaccacaaccccagtcaggcccatgggctctgcttcagcgtacagaagccg
gtttcacccccacccagtttggagaacatgtacaaagaactgtccgtggatatagaaggc
ttccagcatcctggacacggggacctcacaggatgggccaaacagggtgtcctcctgctg
aacgccgtgctaacagttcgagcacaccaagctaactctcaccgtgaccagggctgggaa
accttcacagatgctgtggtcctctggcttaacgcaaacttggatggtctagtctttatg
ctatggggagcttatgcccagagaaagggcgatgtcattaaccggaaacggcaccatgtc
ctgcaagcggcgcacccttcccccttctccgtacaccgtggcttctttggctgcaggcac
ttctccaagactaatgagctgctgcagcgctcagggaagaagcccattgactgggcagcg
ctctga

DBGET integrated database retrieval system