KEGG   Scleropages formosus (Asian bonytongue): 108932609Help
Entry
108932609         CDS       T04919                                 

Gene name
pole
Definition
(RefSeq) DNA polymerase epsilon catalytic subunit A
  KO
K02324  DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm03030  DNA replication
sfm03410  Base excision repair
sfm03420  Nucleotide excision repair
Module
sfm_M00263  DNA polymerase epsilon complex
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108932609 (pole)
   03410 Base excision repair
    108932609 (pole)
   03420 Nucleotide excision repair
    108932609 (pole)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sfm03032]
    108932609 (pole)
   03400 DNA repair and recombination proteins [BR:sfm03400]
    108932609 (pole)
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     108932609 (pole)
DNA replication proteins [BR:sfm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    108932609 (pole)
DNA repair and recombination proteins [BR:sfm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      108932609 (pole)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1744 DNA_pol_B_exo1 DNA_pol_B DNA_pol_B_exo2 RNase_H_2
Motif
Other DBs
NCBI-GeneID: 108932609
NCBI-ProteinID: XP_029102230
UniProt: A0A1W4ZLV3
LinkDB All DBs
Position
19
AA seq 2304 aa AA seqDB search
MVLQNSGRYKANREHAGDPDQQEDAPSLSAVKRLERSQFTDEMDSRFGFERMKEPGEKTG
WLINMHPTEILDDDKQMVSAVDYYFIQEDGSRFKVALPFRPYFYIATKQNCEREVTSFLS
KKFQGKVAKLEMVLKEDLDLPNHLVGLKRNYIKLSFNTVDDLIKVKREISPVVCKNREKE
KCNDAYTVMLTSVLSGGNVVAADEDGMSKKLADQMDNIVDMREYDVPYHVRLSIDLKIHV
AHWYNVRYRGSVFPPEIVQRDDLVERPDPVVLAFDIETTKLPLKFPDAETDQIMMISYMI
DGQGYLITNREIVSEDIEDFEFTPKPEYEGPFSVFNEPDEASLIQRWFEHIHEIKPNIFV
TYNGDFFDWPFVEARAAHHGLSMHQEIGFQKDSQGEYKASQAMHMDCLRWVKRDSYLPVG
SHNLKAAAKAKLGYDPVELDPEEMCRMATEEPQALATYSVSDAVATYYLYMKYVHPFIFA
LCTIIPMEPDEVLRKGSGTLCEALLMVQAFHGNIVFPNKQEQVFNKLTNDGHVLDSETYV
GGHVEALESGVFRSDIPCRFKMNPAAFDFLLHRVERTLHHAIEEEEKIPLEQVLNFKEVC
EEIKKKLISLKEVPNRIECPLIYHLDVGAMYPNIILTNRLQPSAMVDEATCAACDFNKPG
ANCQRKMTWLWRGEVMPATRSEFHRIQQQLESEKFPSLIPSGQPRAFHELIREEQARHEK
KRLSDYCRKAYKKVHLTRLEERVTTICQRENSFYVDTVRAFRDRRYEFKGLHKVWKKKLA
AAQDSGDAAEVKRCKNMEILYESLQLAHKCILNSFYGYVMRKGARWYSMEMAGIVCYTGA
NIITQARELIEQIGRPLELDTDGIWCVLPNTFPENFVIKSSNEKKPKVTISYPGAMLNIM
VKEGFTNHQYQELVDPATLSYETRSENSIFFEVDGPYLAMILPASKEEGKKLKKRYAVFN
EDGSLAELKGFEVKRRGELQLIKIFQSSVFEAFLKGTTLEEVYASVAKVADYWLDVLYSK
AANMPDTELFELISENRSMSRKLEDYGEQKSTSISTAKRLAEFLGDQMVKDAGLSCRYVI
SRKPEGSPVTERAIPLAIFQAEPSIRKHFLRKWLKMPSLHDLDIRSILDWNYYIERLGSA
IQKIITIPAALQQVKNPVPRVRHPDWLHKKLLEKNDIYKQKKISELFTSEGRRQVTSHQP
ALNGSQSSESGEVPDMEDFGMPRHPLQPAILISTKRKRASQGGEHEVESQELELTQSWRE
ILGPPPPSGKTKEERLVWLRYHKKKWELQLRQRRQHRKKRRLTDGGAVPAGGRVIRGGTG
TTDLGNFLRRTARSILDLPWQMTKFVQIAETSHPGLFKLWAVIGNDLHCMKLNIRRVFYV
NQRVPKQEEGANYKKVSRMLPRSNIVYYLYQYTVPEDMYQEHINEINADLAVPDIEGVYE
TQVPLLFRALVQLGCLCMVNKQVVRSLGGRETDTFDLEHLEMRSLAQFGYLEPGSVRHIF
LYHHSQGHKALFGLFFPSQRKASIFVLDTVRSNQMPNLSALYEAERTALLEKTSDDLLPP
EKHTFEVRAENDAKAVDRALQRLLLNYKEERRGPTLIAVQSNWDFRRLATGMPVLEEFPV
VSVHVVDDISYSVLDWQRHGARRMIRHYLNLDSCLSQAFDMARYYHLPVGNLPEDISIFS
SDLFFARHLHKHNHLLWLSPTARPDLGGKEADDSRLIMETEDRGTVEINTPGCYSAVCVE
LDLQSLAVNTILQSQHVNDMEGGASLGVSFDVLQQASLEDMMSGNQGSPAVASYDETALC
SSTFRILKSMVVGWVKEITQYHNVYADNQVMHFYRWLCSPSSLLYDPALHRTLHTMMKKV
FLQLVAEFKRLGSSVIYGNFNRILLSTKKRRLDDALAYVEYITNSIHSKEIFHSLSISFS
RCWEFLLWMDLTNYGGVKGKLPSSILYQEDGKVQKKLRDKEGAEDYSDDENEEEDAEPGG
EDDIESDVEDLIESNWNIMQYLPQTASCQKYFLMIISAYIAAVYHSMKEELQRNAPGATP
IKKRGVSEASQQAMGDTNALPGMITFSQEYVSSELTQNVFTITQKIQKKVTGSRSGTLLS
AMFPSLPGSHLPLNNPALEFIKYVCQVLSLDANITNQVNKLKRNLLRLVDVGEFSEEAQF
HDPCKSFVLPEVICRHCNFCRDLDLCKDPSVAPDGSVLPQWFCSNCQAQYETEAIEMTLV
ECLQKKLMAYTLQDLVCVKCKGVKEANMPIYCSCAGDFTLTFSTKSFWEQIGVFQNIAAH
YSMHFLQETIDWLLHISPELTKKM
NT seq 6915 nt NT seq  +upstreamnt  +downstreamnt
atggttcttcaaaacagtggaagatataaggcgaatcgggagcatgcaggagaccccgat
cagcaggaagatgcacccagtctgtctgctgtaaaacgcttggagcgcagccagttcaca
gatgagatggacagccgctttgggttcgagaggatgaaggagccaggggagaagacaggc
tggctgatcaacatgcatccaacagaaatcttggatgatgataagcaaatggttagtgct
gtggactattatttcattcaggaggatggtagcagattcaaggtggcactccccttcaga
ccctatttttatatagccactaaacagaactgcgagagagaagttacgtccttcctgtcc
aagaagtttcaggggaaggttgcaaaactggagatggtcttgaaagaagatttggatctg
ccaaatcacttggtgggtctgaaaagaaactacatcaagctttccttcaacactgtggat
gacctcatcaaagttaagcgcgaaatctcaccggtggtatgcaagaatcgtgagaaggag
aagtgcaacgatgcctacactgtaatgctaacaagtgtcttgtctggtggaaatgttgtg
gcggcagatgaggacggaatgtccaaaaagcttgcagaccagatggataacatcgtggac
atgcgagaatatgatgtaccataccatgtccgtttgtcgattgacctcaaaattcatgtg
gctcactggtacaacgtgcgctatcgaggcagtgtctttcctcccgaaattgtgcagaga
gatgatcttgtagagagaccagatccggtggtgcttgccttcgacatagagaccaccaag
ctgcctctgaagttccccgatgcggagactgatcagatcatgatgatctcttatatgatc
gatggtcagggatacctgatcacaaacagggagattgtctctgaagatattgaagatttt
gaattcaccccaaaaccggagtatgaagggcccttctctgtgttcaatgaaccagatgag
gcctctctcatccagaggtggtttgaacacatccatgagatcaagccaaatatttttgtt
acgtacaacggtgatttctttgactggccctttgtggaggcccgggcagcccaccatggg
ctgagcatgcaccaggaaattgggttccagaaggacagtcagggggagtacaaggcgagc
caggccatgcatatggactgcctgaggtgggtgaaacgtgacagctacctgcctgttggg
agccacaacttgaaagcagcagccaaggccaagctgggttacgaccctgtggagctggac
cctgaggagatgtgccgcatggcaaccgaggaaccacaggctcttgccacctactctgtg
tcagatgcagtggccacatactacctgtacatgaagtatgttcaccccttcatctttgca
ctgtgcaccatcattcccatggagccagatgaggtgttgcggaagggctctgggacgctg
tgtgaggctctgctcatggtgcaagctttccatggcaatattgtgttccccaacaagcaa
gaacaggttttcaacaagcttaccaacgatggccatgtgcttgattctgagacctacgtg
gggggccatgttgaagcgctggagtctggggtcttccgcagcgacatcccatgtcgtttt
aagatgaatccagcagcattcgacttcctgctgcacagagtagagcgaaccttgcatcat
gccatagaggaggaggagaagattccccttgagcaggtcctcaatttcaaagaggtgtgt
gaggaaataaaaaagaagctgatctccctgaaagaggtgccaaacaggatagagtgtccg
ctcatttatcaccttgatgttggggccatgtatcccaacatcatcctcactaaccgtttg
cagccatcggccatggtggatgaggccacttgcgctgcctgtgacttcaacaaaccagga
gccaactgccagaggaagatgacttggctgtggagaggcgaagtcatgccagctacccgc
agtgaattccaccgcatccagcagcaactggagtctgagaagttcccctccctgatcccc
agtggccagccacgtgccttccatgagttgatccgtgaggagcaggcacgccatgagaag
aaacggctcagcgactactgtaggaaagcctacaagaaagtgcacctgacaaggcttgag
gagcgtgtcaccaccatctgccagagggagaactccttttatgtggacactgtacgggcc
tttcgagatcgccgctacgagtttaaagggctgcacaaggtgtggaagaagaagctggca
gctgctcaagacagtggtgatgcagcagaagtgaaacgttgcaaaaacatggaaatcttg
tatgagtctttacagctggcccataagtgcatcctcaattctttctatggatatgtcatg
cgaaagggggcacgttggtactccatggagatggctgggattgtttgctacactggtgcc
aacatcatcacgcaagccagggagcttatagagcaaattgggaggcctcttgagttggac
acagatggtatctggtgtgttctcccaaacacctttcctgaaaattttgtcatcaaatcc
agtaatgagaaaaagccaaaggtgaccatctcatatcccggtgctatgctcaacattatg
gtgaaggaaggattcaccaaccaccagtaccaggagctggtggaccctgcaaccttatcc
tatgaaacacgatctgaaaatagtatcttttttgaggtggatgggccctacctggccatg
atcctaccagcatccaaagaggagggcaagaaacttaaaaagaggtatgccgtgttcaat
gaagatggctctcttgctgaactgaagggctttgaggtgaagcggcgaggagagttacag
ctcatcaaaatcttccagtcctcagtgttcgaggctttccttaagggcaccacactggag
gaggtctacgcttctgtagcgaaagtggctgactactggctggatgtactctacagcaag
gctgccaacatgccggatacagagctgtttgagctgatctctgagaaccgttccatgtcc
cgcaagctggaggactacggcgagcaaaagtctacctccatcagcacagccaagcgcctg
gctgagttcttaggtgaccaaatggtgaaagacgctggtctaagctgccgctacgtcatc
tcccgcaaacctgagggctcccctgttactgagagggccatcccacttgccatcttccag
gctgagcccagtataaggaaacactttctgcgcaaatggctcaagatgcccagcctccac
gacttagacatccgctctatactggattggaactattacattgaacggctagggagtgcc
atacagaaaatcatcaccattcccgcagccctgcagcaggtgaagaacccagtgccaagg
gtccgtcaccctgactggttgcacaagaagctgctggaaaagaacgacatctacaaacag
aagaagatcagtgaactcttcaccagtgagggcaggagacaggtgacctcccaccagcca
gcccttaatggtagtcagtcttcagaatctggggaggtgccggacatggaggactttggt
atgccgcggcaccccctgcaacctgccattctcatcagcactaaacgcaagagagcatcc
cagggtggggaacacgaggtggagtcacaagagctggagctcacgcagtcatggagggag
atccttggcccgccaccaccctctggaaaaacaaaggaagagcgcctggtgtggctacgc
taccacaaaaagaagtgggagctacagctgcgccagcgacgacagcatcgcaagaaacgg
cgtctgaccgatggtggggctgtgcccgcagggggtagggtgatccggggaggcactggc
accactgatctaggaaactttctgcgtcggacagcccgcagtatccttgaccttccctgg
cagatgacaaaatttgtgcagattgcagagacgagtcatccaggcctgttcaagctctgg
gctgtaattggcaatgacctgcactgcatgaagctcaacattcgccgtgtcttctatgtg
aaccagagggttcccaaacaagaggaaggagccaactacaagaaggtcagtcgaatgctg
cctcgttccaacatagtttattacctgtatcagtacacagtacctgaggatatgtaccag
gagcacatcaacgagatcaatgctgacctcgctgtccccgatatagaaggtgtttacgag
acacaggttcctctcctgttccgcgcacttgtgcagctgggttgcttgtgcatggtcaac
aaacaggtggtccgcagcctaggtggccgtgagacagacactttcgacctagaacatctg
gagatgaggtccctagctcagtttggttatctggagcctggtagtgtgcgccatattttc
ctgtaccaccacagccagggtcacaaagccctgtttggtctcttcttcccatcccagcgc
aaggccagcatctttgttctggacacggtccgcagtaaccagatgcccaacctgagcgcc
ctgtacgaggctgagcgcactgccctactggagaagaccagtgatgatctcctccctccg
gagaaacacacattcgaagtgcgagcggaaaatgacgccaaggctgtggaccgtgcctta
cagcgtctgctgctcaactacaaggaagagcgccggggtcccaccctgatcgctgtgcag
tccaactgggatttccgccgtttggcaacaggaatgccagttctggaagaattcccagta
gtgtcagtacatgtggtggatgacatcagctacagtgtactggactggcagcgccatggt
gcacggcgcatgattcgacattaccttaacctggacagctgcctgtcccaggcattcgac
atggccaggtactaccatttgcctgtggggaacctccctgaggacatttccatcttcagc
tctgacctgttctttgctcgacacctgcacaagcacaaccacctgctgtggctgtcacca
acagcacggcccgacctgggaggcaaagaggccgatgacagccgcctaatcatggagact
gaggatcggggcactgtggagatcaacacaccaggctgttactccgcagtgtgtgtggag
ctggacctccagagccttgccgtcaacaccatcctgcagtcccagcacgtcaatgacatg
gagggcggcgctagcctgggtgtcagctttgacgtccttcagcaggcctccttagaagac
atgatgtcaggaaaccagggttcccctgcagttgccagctatgatgagacagcgctctgc
tccagcactttcaggattctaaagagcatggtggtaggctgggtgaaggagattacgcag
taccacaacgtgtatgcggacaaccaggtgatgcacttctaccgctggctgtgctcgcct
agctcgctgctgtacgatccggcactgcaccgcacactgcacaccatgatgaagaaggtc
tttctgcaattagttgcagagttcaaacgtctgggctcctctgtaatctatgggaacttc
aataggatcctgttgtccaccaagaagcggcgactggatgatgctcttgcctacgtggaa
tacatcaccaacagcatccactcaaaggagattttccactcgttgtccatctctttctca
cgatgctgggagtttctgctgtggatggatctgaccaactacggaggggtgaagggcaaa
cttccttccagcattctgtaccaagaggatggaaaggtgcagaaaaagcttagagacaag
gagggagcagaagactacagtgatgatgaaaatgaagaggaggatgctgagccaggagga
gaggatgacatagagagcgatgtggaggacctaattgagagtaactggaatattatgcag
tatcttccccagacagcctcttgtcagaagtactttctgatgatcatctcagcttacatc
gcagctgtctatcatagcatgaaggaggaactgcaacgcaatgcccctggggccacaccc
attaaaaagaggggggtgagcgaagcctcacagcaagcaatgggagacaccaacgccttg
cctggtatgatcaccttttcccaggagtatgtgtcaagtgaactgacacagaatgtcttc
accatcactcagaagattcagaagaaggtgacaggcagcaggagtggcacgctgctgtcg
gctatgttccccagcctgcctggttcccatctgcccctcaacaaccctgcactggagttc
atcaaatatgtctgccaggtattgtccttggatgccaacatcaccaatcaggtgaacaag
ctcaagaggaaccttttgcgtctagtagatgtgggcgagttctctgaagaggcccagttt
catgacccttgcaagtcctttgtcctcccagaagtcatctgccgccactgtaacttctgc
cgggacttagatctttgcaaggatccttctgtagcaccggatggctcagtcctcccccag
tggttctgctccaactgtcaggcacagtacgagacagaggccatcgagatgacattggtg
gagtgtcttcagaagaagcttatggcgtatactttgcaggacttggtttgtgtgaaatgc
aaaggtgtgaaggaagccaacatgcccatctactgcagctgcgcgggagacttcacgctc
acgttctccaccaagagcttctgggaacaaatcggagtgttccagaacatcgcagcccac
tacagtatgcacttcctgcaggagaccatcgactggctgctccacataagtccagagctg
accaaaaagatgtag

DBGET integrated database retrieval system